Solution NMR Structure of PDFL2.1 from Arabidopsis thaliana
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS14:SG | 1:CYS36:SG |
2 | disulfide | sing | 1:CYS22:SG | 1:CYS47:SG |
3 | disulfide | sing | 1:CYS26:SG | 1:CYS49:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.1 % (546 of 649) | 97.6 % (330 of 338) | 63.3 % (162 of 256) | 98.2 % (54 of 55) |
Backbone | 80.9 % (262 of 324) | 99.1 % (111 of 112) | 62.5 % (100 of 160) | 98.1 % (51 of 52) |
Sidechain | 89.1 % (334 of 375) | 96.9 % (219 of 226) | 76.7 % (112 of 146) | 100.0 % (3 of 3) |
Aromatic | 41.7 % (25 of 60) | 83.3 % (25 of 30) | 0.0 % (0 of 30) | |
Methyl | 100.0 % (56 of 56) | 100.0 % (28 of 28) | 100.0 % (28 of 28) |
1. entity
KDIDGRKPLL IGTCIEFPTE KCNKTCIESN FAGGKCVHIG QSLDFVCVCF PKYYISolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM peptide in a buffer of 40 mM KCl, 20 mM KH2PO4, 1 mM NaN3 at pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 mM | |
2 | potassium chloride | natural abundance | 40 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25468_2mz0.nef |
Input source #2: Coordindates | 2mz0.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50----- KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI ||||||||||||||||||||||||||||||||||||||||||||||||||||||| KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 55 | 0 | 0 | 100.0 |
Content subtype: combined_25468_2mz0.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50----- KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI ||||||||||||||||||||||||||||||||||||||||||||||||||||||| KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 338 | 330 | 97.6 |
13C chemical shifts | 256 | 161 | 62.9 |
15N chemical shifts | 56 | 55 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 112 | 111 | 99.1 |
13C chemical shifts | 110 | 49 | 44.5 |
15N chemical shifts | 52 | 51 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 226 | 219 | 96.9 |
13C chemical shifts | 146 | 112 | 76.7 |
15N chemical shifts | 4 | 4 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 28 | 100.0 |
13C chemical shifts | 28 | 28 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 25 | 83.3 |
13C chemical shifts | 30 | 0 | 0.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50----- KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI ||||||||||||||||||||||||||||||||||||||||||||||||||||||| KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI
Dihedral angle restraints
--------10--------20--------30--------40--------50----- KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI |||||||||| ||| ||||||||||||||| |||||||||||||||||||||| ..IDGRKPLLIG.CIE.PTEKCNKTCIESNFA.GKCVHIGQSLDFVCVCFPKYYI