AQ1974
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.2 % (989 of 1096) | 89.1 % (516 of 579) | 93.8 % (392 of 418) | 81.8 % (81 of 99) |
Backbone | 92.7 % (473 of 510) | 90.8 % (158 of 174) | 94.5 % (239 of 253) | 91.6 % (76 of 83) |
Sidechain | 89.1 % (594 of 667) | 88.4 % (358 of 405) | 93.9 % (231 of 246) | 31.3 % (5 of 16) |
Aromatic | 93.7 % (118 of 126) | 93.7 % (59 of 63) | 96.5 % (55 of 57) | 66.7 % (4 of 6) |
Methyl | 93.8 % (75 of 80) | 95.0 % (38 of 40) | 92.5 % (37 of 40) |
1. Aq1974
GSEEKEEKKV RELTPQELEL FKRAMGITPH NYWQWASRTN NFKLLTDGEW VWVEGYEEHI GKQLPLNQAR AWSWEFIKNR LKELNLSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Bruker Avance III HD - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aq1974 | [U-100% 13C; U-100% 15N] | 0.332 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 93 % | |
5 | D20 | natural abundance | 7 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr25530_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80------ GSEEKEEKKVRELTPQELELFKRAMGITPHNYWQWASRTNNFKLLTDGEWVWVEGYEEHIGKQLPLNQARAWSWEFIKNRLKELNL ||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| |||||||||||||||||||| ...EKEEKKVRELTPQELELFKRAMGIT.HNYWQWASRTNNFKLLTDGEWVWVEGYEEHIGKQLP.NQARAWSWEFIKNRLKELNL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 579 | 509 | 87.9 |
13C chemical shifts | 418 | 385 | 92.1 |
15N chemical shifts | 104 | 77 | 74.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 174 | 158 | 90.8 |
13C chemical shifts | 172 | 159 | 92.4 |
15N chemical shifts | 83 | 73 | 88.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 405 | 351 | 86.7 |
13C chemical shifts | 246 | 226 | 91.9 |
15N chemical shifts | 21 | 4 | 19.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 39 | 95.1 |
13C chemical shifts | 41 | 37 | 90.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 59 | 93.7 |
13C chemical shifts | 57 | 55 | 96.5 |
15N chemical shifts | 6 | 4 | 66.7 |