Solution structure of the GBII-beta MRH domain W409A point mutant
YRAIKGMETK REIGGYTYKV VFYENVFQDS ILLGNFASQE GNVLKYENGQ SCANGPHRSA IVTVECGVEN EIVSVLEAQK CEYLIKMKSP AACS
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS52:SG | 1:CYS81:SG |
2 | disulfide | sing | 1:CYS66:SG | 1:CYS93:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.7 % (970 of 1081) | 92.2 % (517 of 561) | 85.4 % (357 of 418) | 94.1 % (96 of 102) |
Backbone | 92.3 % (517 of 560) | 94.3 % (183 of 194) | 90.5 % (248 of 274) | 93.5 % (86 of 92) |
Sidechain | 88.0 % (534 of 607) | 91.0 % (334 of 367) | 82.6 % (190 of 230) | 100.0 % (10 of 10) |
Aromatic | 68.3 % (56 of 82) | 87.8 % (36 of 41) | 48.8 % (20 of 41) | |
Methyl | 93.0 % (93 of 100) | 98.0 % (49 of 50) | 88.0 % (44 of 50) |
1. entity
YRAIKGMETK REIGGYTYKV VFYENVFQDS ILLGNFASQE GNVLKYENGQ SCANGPHRSA IVTVECGVEN EIVSVLEAQK CEYLIKMKSP AACSSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MRH GIIb | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | imidazole | [U-99% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MRH GIIb | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | imidazole | [U-99% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MRH GIIb | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | imidazole | [U-99% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MRH GIIb | [U-99% 13C; U-99% 15N] | 0.7 mM | |
2 | imidazole | [U-99% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25560_2n1h.nef |
Input source #2: Coordindates | 2n1h.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:408:CYS:SG | A:437:CYS:SG | oxidized, CA 55.139, CB 44.133 ppm | oxidized, CA 57.722, CB 42.191 ppm | 2.027 |
A:422:CYS:SG | A:449:CYS:SG | oxidized, CA 57.084, CB 39.228 ppm | oxidized, CA 55.786, CB 42.838 ppm | 2.008 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---360-----370-------380-------390-------400-------410-------420-------430-------440-------450 YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCANGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCANGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACS --------10--------20--------30--------40--------50--------60--------70--------80--------90----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
Content subtype: combined_25560_2n1h.nef
Assigned chemical shifts
---360-----370-------380-------390-------400-------410-------420-------430-------440-------450 YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCANGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACS || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..AI.GMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCANGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 561 | 517 | 92.2 |
13C chemical shifts | 418 | 356 | 85.2 |
15N chemical shifts | 105 | 96 | 91.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 194 | 183 | 94.3 |
13C chemical shifts | 188 | 166 | 88.3 |
15N chemical shifts | 92 | 86 | 93.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 367 | 334 | 91.0 |
13C chemical shifts | 230 | 190 | 82.6 |
15N chemical shifts | 13 | 10 | 76.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 51 | 98.1 |
13C chemical shifts | 52 | 46 | 88.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 36 | 87.8 |
13C chemical shifts | 41 | 20 | 48.8 |
Covalent bonds
Distance restraints
---360-----370-------380-------390-------400-------410-------420-------430-------440-------450 YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCANGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACS | || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...I.GM.TKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCANGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACS
Dihedral angle restraints
---360-----370-------380-------390-------400-------410-------420-------430-------440-------450 YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCANGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACS |||| ||||||||||||| |||| ||| |||||||||||||||||||| |||||||| ||||||||||| |||||||||||| ..AIKG.ETKREIGGYTYKV...ENVF..SIL.GNFASQEGNVLKYENGQSCA....RSAIVTVE.GVENEIVSVLE....EYLIKMKSPAAC ---360-----370-------380-------390-------400-------410-------420-------430-------440---------