BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	87.1 % (1136 of 1304)	86.2 % (594 of 689)	87.8 % (437 of 498)	89.7 % (105 of 117)
Backbone	87.1 % (573 of 658)	85.9 % (195 of 227)	87.0 % (282 of 324)	89.7 % (96 of 107)
Sidechain	87.3 % (653 of 748)	86.4 % (399 of 462)	88.8 % (245 of 276)	90.0 % (9 of 10)
Aromatic	68.9 % (62 of 90)	68.9 % (31 of 45)	68.9 % (31 of 45)
Methyl	100.0 % (82 of 82)	100.0 % (41 of 41)	100.0 % (41 of 41)

1. SUMO1

MGSSHHHHHH SQDPMSDQEA KPSTEDLGDK KEGEYIKLKV IGQDSSEIHF KVKMTTHLKK LKESYCQRQG VPMNSLRFLF EGQRIADNHT PKELGMEEED VIEVYQEQTG G

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 15N SUMO1

#	Name	Isotope labeling	Concentration
9	SUMO1	[U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
10	potassium phosphate	natural abundance	10 (±1.0) mM
11	potassium chloride	natural abundance	100 (±1.0) mM
12	DTT	natural abundance	2 (±0.05) mM
13	EDTA	natural abundance	0.1 (±0.005) mM
14	sodium azide	natural abundance	0.001 (±0.001) %
15	H2O	natural abundance	90 %
16	D2O	natural abundance	10 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 15N SUMO1 in Pf1 phage alignment medium.

#	Name	Isotope labeling	Concentration
17	SUMO1	[U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
18	potassium phosphate	natural abundance	10 (±1.0) mM
19	potassium chloride	natural abundance	100 (±1.0) mM
20	DTT	natural abundance	2 (±0.05) mM
21	EDTA	natural abundance	0.1 (±0.005) mM
22	sodium azide	natural abundance	0.001 (±0.001) %
23	Pf1 phage	natural abundance	10 (±0.1) w/v
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

Sample #4

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details SUMO1

#	Name	Isotope labeling	Concentration
26	SUMO1	natural abundance	0.5 ~ 1.0 (±0.05) mM
27	potassium phosphate	natural abundance	10 (±1.0) mM
28	potassium chloride	natural abundance	100 (±1.0) mM
29	DTT	natural abundance	2 (±0.05) mM
30	EDTA	natural abundance	0.1 (±0.005) mM
31	sodium azide	natural abundance	0.001 (±0.001) %
32	H2O	natural abundance	90 %
33	D2O	natural abundance	10 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.03 ppm, Outliers: 2 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.03 ppm, Outliers: 2 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.02 ppm, Outliers: 3 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.09 ppm, Outliers: 2 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2N1V, Strand ID: A Detail

Release date

2016-04-17

Citation

Structures of human SUMO
Naik, M.T., Naik, N., Shih, H., Huang, T.
Not known

Related entities 1. human SUMO1, : 1 : 28 : 42 entities Detail

Interaction partners 1. human SUMO1, : 123 interactors Detail

More details for 123 interactors identified by 62 citations

Experiments performed 17 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 15N SUMO1

#	Name	Isotope labeling	Concentration
9	SUMO1	[U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
10	potassium phosphate	natural abundance	10 (±1.0) mM
11	potassium chloride	natural abundance	100 (±1.0) mM
12	DTT	natural abundance	2 (±0.05) mM
13	EDTA	natural abundance	0.1 (±0.005) mM
14	sodium azide	natural abundance	0.001 (±0.001) %
15	H2O	natural abundance	90 %
16	D2O	natural abundance	10 %

2 2D 1H-13C HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

3 3D HNCO

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

4 3D HNCA

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

5 3D HN(CO)CA

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

6 3D HNCACB

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

7 3D CBCA(CO)NH

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

8 3D HCCH-TOCSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

9 3D HCCH-COSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

10 3D HBHAcoNH

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

11 2D-hbCBcgcdHD

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

12 2D-hbCBcgcdceHE

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

13 3D 1H-15N TOCSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

14 2D 1H-1H NOESY

Instrument

Bruker Avance - 850 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details SUMO1

#	Name	Isotope labeling	Concentration
26	SUMO1	natural abundance	0.5 ~ 1.0 (±0.05) mM
27	potassium phosphate	natural abundance	10 (±1.0) mM
28	potassium chloride	natural abundance	100 (±1.0) mM
29	DTT	natural abundance	2 (±0.05) mM
30	EDTA	natural abundance	0.1 (±0.005) mM
31	sodium azide	natural abundance	0.001 (±0.001) %
32	H2O	natural abundance	90 %
33	D2O	natural abundance	10 %

15 3D 1H-15N NOESY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

16 3D 1H-13C NOESY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 13C, 15N SUMO1

#	Name	Isotope labeling	Concentration
1	SUMO1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
2	potassium phosphate	natural abundance	10 (±1.0) mM
3	potassium chloride	natural abundance	100 (±1.0) mM
4	DTT	natural abundance	2 (±0.05) mM
5	EDTA	natural abundance	0.1 (±0.005) mM
6	sodium azide	natural abundance	0.001 (±0.001) %
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

17 2D 1H-15N HSQC IPAP

Instrument

Bruker Avance - 600 MHz

Sample

State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 290 (±0.1) K, pH 6.5 (±0.1), Details 15N SUMO1 in Pf1 phage alignment medium.

#	Name	Isotope labeling	Concentration
17	SUMO1	[U-100% 15N]	0.5 ~ 1.0 (±0.05) mM
18	potassium phosphate	natural abundance	10 (±1.0) mM
19	potassium chloride	natural abundance	100 (±1.0) mM
20	DTT	natural abundance	2 (±0.05) mM
21	EDTA	natural abundance	0.1 (±0.005) mM
22	sodium azide	natural abundance	0.001 (±0.001) %
23	Pf1 phage	natural abundance	10 (±0.1) w/v
24	H2O	natural abundance	90 %
25	D2O	natural abundance	10 %

NMR combined restraints 6 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints	combined_25576_2n1v.nef
Input source #2: Coordindates	2n1v.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

----------------------10--------20--------30--------40--------50--------60--------70--------80------
MGSSHHHHHHSQDPMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEED
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MGSSHHHHHHSQDPMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEED
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

--90-------
VIEVYQEQTGG
|||||||||||
VIEVYQEQTGG
-------110-

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	111	0	0	100.0

Content subtype: combined_25576_2n1v.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chemical_shifts	Warning	1144		87.4 (chain: A, length: 111)
1	Distance restraints	CNS/XPLOR_distance_constraints_5	OK	3123 (1)	noe	87.4 (chain: A, length: 111)
2	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	56 (1)	hbond	33.3 (chain: A, length: 111)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_2	OK	136 (136)	.	66.7 (chain: A, length: 111)
1	RDC restraints	CNS/XPLOR_dipolar_coupling_4	OK	60 (60)	.	54.1 (chain: A, length: 111)

Assigned chemical shifts

Saveframe: assigned_chemical_shifts
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 111, Sequence coverage: 87.4%
- Total number of assignments
  - ¹H chemical shifts: 607
  - ¹³C chemical shifts: 433
  - ¹⁵N chemical shifts: 104
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	689	607	88.1
¹³C chemical shifts	498	433	86.9
¹⁵N chemical shifts	120	104	86.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	227	199	87.7
¹³C chemical shifts	222	190	85.6
¹⁵N chemical shifts	107	94	87.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	462	408	88.3
¹³C chemical shifts	276	243	88.0
¹⁵N chemical shifts	13	10	76.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	46	45	97.8
¹³C chemical shifts	46	45	97.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	45	30	66.7
¹³C chemical shifts	45	30	66.7

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_5
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 111, Sequence coverage: 87.4%
- Total number of restraints: 3117
- Weight of restraints: 1.0 (3117)
- Potential type of restraints: square-well-parabolic (3117)
- Range of distance target values: 2.09, 3.9 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_3
  - Status: OK
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 111, Sequence coverage: 33.3%
  - Total number of restraints: 56
  - Weight of restraints: 1.0 (56)
  - Potential type of restraints: square-well-parabolic (56)
  - Range of distance target values: 1.96, 2.46 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_2
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 111, Sequence coverage: 66.7%
- Total number of restraints: 136
- Total number of restraints per polymer type: 136
- Weight of restraints: 1.0 (136)
- Potential type of restraints: square-well-parabolic (136)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

RDC restraints

Saveframe: CNS/XPLOR_dipolar_coupling_4

Status: OK
Experiment type: .

Sequence coverage of experimental data

Entity_assembly_ID: A, Chain length: 111, Sequence coverage: 54.1%

----------------------10--------20--------30--------40--------50--------60--------70--------80------
MGSSHHHHHHSQDPMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEED
               | | |  ||  |||  ||| | ||||| | |||| |  ||  |  ||| || | |   ||||| ||| | | |||    ||| ||
...............S.Q.A..ST..LGD..EGE.I.LKVIG.D.SEIH.K..MT..L..LKE.YC.R.G...NSLRF.FEG.R.A.NHT....GME.ED
----------------------10--------20--------30--------40--------50--------60--------70--------80------

--90-------
VIEVYQEQTGG
||||| |||| 
VIEVY.EQTG 
--90------

Total number of restraints: 60
Potential type of restraints: undefined (60)
Range of observed RDC values: 100.0, -100.0 (Hz)
RDC restraints per residue
- Chain_ID: A
  None

Keywords SUMO, Ubiquitin-like protein

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (2.001 seconds)

BMRB: 25576

Sample #1

Sample #2

Sample #3

Sample #4

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. human SUMO1, : 1 : 28 : 42 entities Detail

Interaction partners 1. human SUMO1, : 123 interactors Detail

Experiments performed 17 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 6 contents Detail