Solution structure of the meiosis-expressed gene 1 (Meig1)
GSHMMATSDV KPKSISRAKK WSEEIENLYR FQQAGYRDEI EYKQVKQVAM VDRWPETGYV KKLQRRDNTF FYYNKERECE DKEVHKVKVY VY
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.9 % (1067 of 1161) | 90.9 % (560 of 616) | 92.1 % (410 of 445) | 97.0 % (97 of 100) |
Backbone | 96.5 % (529 of 548) | 96.2 % (178 of 185) | 96.7 % (264 of 273) | 96.7 % (87 of 90) |
Sidechain | 89.2 % (626 of 702) | 88.6 % (382 of 431) | 89.7 % (234 of 261) | 100.0 % (10 of 10) |
Aromatic | 71.4 % (90 of 126) | 76.2 % (48 of 63) | 65.6 % (40 of 61) | 100.0 % (2 of 2) |
Methyl | 100.0 % (70 of 70) | 100.0 % (35 of 35) | 100.0 % (35 of 35) |
1. entity
GSHMMATSDV KPKSISRAKK WSEEIENLYR FQQAGYRDEI EYKQVKQVAM VDRWPETGYV KKLQRRDNTF FYYNKERECE DKEVHKVKVY VYSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 10 mM | |
2 | Meig1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_25627_2n2y.nef |
Input source #2: Coordindates | 2n2y.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------10--------20--------30--------40--------50--------60--------70--------80-------- GSHMMATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMMATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY --------10--------20--------30--------40--------50--------60--------70--------80--------90--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 92 | 0 | 0 | 100.0 |
Content subtype: combined_25627_2n2y.nef
Assigned chemical shifts
------------10--------20--------30--------40--------50--------60--------70--------80-------- GSHMMATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HMMATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 616 | 553 | 89.8 |
13C chemical shifts | 445 | 410 | 92.1 |
15N chemical shifts | 107 | 99 | 92.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 185 | 178 | 96.2 |
13C chemical shifts | 184 | 176 | 95.7 |
15N chemical shifts | 90 | 87 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 431 | 375 | 87.0 |
13C chemical shifts | 261 | 234 | 89.7 |
15N chemical shifts | 17 | 12 | 70.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 35 | 92.1 |
13C chemical shifts | 38 | 35 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 48 | 76.2 |
13C chemical shifts | 61 | 40 | 65.6 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
------------10--------20--------30--------40--------50--------60--------70--------80-------- GSHMMATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....MATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY
Dihedral angle restraints
------------10--------20--------30--------40--------50--------60--------70--------80-------- GSHMMATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....MAT.DVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY
RDC restraints
------------10--------20--------30--------40--------50--------60--------70--------80-------- GSHMMATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY ||||||||||||||||||||||||||||||||||||| |||| |||| |||||||||||||||||||||||||| | | ...........PKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQV..VDRW.ETGY.KKLQRRDNTFFYYNKERECEDKEVHK.K...Y