NMR structure of the C-terminal region of human eukaryotic elongation factor 1B
GPGSEDDDID LFGSDNEEED KEAAQLREER LRQYAEKKAK KPALVAKSSI LLDVKPWDDE TDMAQLEACV RSIQLDGLVW GASKLVPVGY GIRKLQIQCV VEDDKVGTDL LEEEITKFEE HVQSVDIAAF NKI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.0 % (1487 of 1533) | 96.4 % (771 of 800) | 97.6 % (579 of 593) | 97.9 % (137 of 140) |
Backbone | 98.5 % (778 of 790) | 97.4 % (263 of 270) | 99.5 % (389 of 391) | 97.7 % (126 of 129) |
Sidechain | 96.1 % (834 of 868) | 95.8 % (508 of 530) | 96.3 % (315 of 327) | 100.0 % (11 of 11) |
Aromatic | 75.7 % (56 of 74) | 75.7 % (28 of 37) | 74.3 % (26 of 35) | 100.0 % (2 of 2) |
Methyl | 100.0 % (156 of 156) | 100.0 % (78 of 78) | 100.0 % (78 of 78) |
1. entity
GPGSEDDDID LFGSDNEEED KEAAQLREER LRQYAEKKAK KPALVAKSSI LLDVKPWDDE TDMAQLEACV RSIQLDGLVW GASKLVPVGY GIRKLQIQCV VEDDKVGTDL LEEEITKFEE HVQSVDIAAF NKISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 0.8 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DSS | natural abundance | 0.01 % w/v | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25690_2n51.nef |
Input source #2: Coordindates | 2n51.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-150-----160-------170-------180-------190-------200-------210-------220-------230-------240-------2 GPGSEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGSEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 50-------260-------270-------280- VEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI ||||||||||||||||||||||||||||||||| VEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI -------110-------120-------130---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 133 | 0 | 0 | 100.0 |
Content subtype: combined_25690_2n51.nef
Assigned chemical shifts
-150-----160-------170-------180-------190-------200-------210-------220-------230-------240-------2 GPGSEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PGSEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCV 50-------260-------270-------280- VEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI ||||||||||||||||||||||||||||||||| VEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 800 | 773 | 96.6 |
13C chemical shifts | 593 | 579 | 97.6 |
15N chemical shifts | 145 | 137 | 94.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 270 | 265 | 98.1 |
13C chemical shifts | 266 | 264 | 99.2 |
15N chemical shifts | 129 | 126 | 97.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 530 | 508 | 95.8 |
13C chemical shifts | 327 | 315 | 96.3 |
15N chemical shifts | 16 | 11 | 68.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 79 | 79 | 100.0 |
13C chemical shifts | 79 | 79 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 28 | 75.7 |
13C chemical shifts | 35 | 26 | 74.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-150-----160-------170-------180-------190-------200-------210-------220-------230-------240-------2 GPGSEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PGSEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCV 50-------260-------270-------280- VEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI ||||||||||||||||||||||||||||||||| VEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI
-150-----160-------170-------180-------190-------200-------210-------220-------230-------240-------2 GPGSEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCV ||||||||||||||||| |||||||| |||||||||| | | || | | | | ||||||| ....................KEAAQLREERLRQYAEK..........SSILLDVK......DMAQLEACVR.....G.V.GA.K.V.V...I.KLQIQCV -150-----160-------170-------180-------190-------200-------210-------220-------230-------240-------2 50-------260-------270-------280- VEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI || |||||||||||| | | | | VE.....TDLLEEEITKFE....S.D..A.N 50-------260-------270---------
Dihedral angle restraints
-150-----160-------170-------180-------190-------200-------210-------220-------230-------240-------2 GPGSEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCV ||||| ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......DIDLF.......DKEAAQLREERLRQYAEKK.....LVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCV 50-------260-------270-------280- VEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI ||||||||||||||||||||||||||||||||| VEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI