Structure of constitutively monomeric CXCL12 in complex with the CXCR4 N-terminus
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.8 % (1222 of 1303) | 95.3 % (656 of 688) | 91.7 % (454 of 495) | 93.3 % (112 of 120) |
Backbone | 96.0 % (624 of 650) | 96.8 % (213 of 220) | 95.7 % (311 of 325) | 95.2 % (100 of 105) |
Sidechain | 92.5 % (701 of 758) | 94.7 % (443 of 468) | 89.5 % (246 of 275) | 80.0 % (12 of 15) |
Aromatic | 78.0 % (78 of 100) | 94.0 % (47 of 50) | 61.2 % (30 of 49) | 100.0 % (1 of 1) |
Methyl | 92.0 % (81 of 88) | 95.5 % (42 of 44) | 88.6 % (39 of 44) |
1. entity 1
GMKPVSLSYR CPCRFFESHV ARANVKHLKI LNTPNCALQI VARLKNNNRQ VCIDPKCKWC QEYLEKALNK2. entity 2
GSMEGISIYT SDNYTEEMGS GDYDSMKEPA FREENANFNKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 2 mM | |
2 | MES | [U-2H] | 25 mM | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | entity_2 | natural abundance | 2 mM | |
6 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_2 | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | MES | [U-2H] | 25 mM | |
9 | sodium azide | natural abundance | 0.02 % | |
10 | D2O | [U-99% 2H] | 10 % | |
11 | entity_1 | natural abundance | 2 mM | |
12 | H2O | [U-99% 2H] | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 600 MHz Equipped with a 1H/13C/15N TXI Cryoprobe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 2 mM | |
2 | MES | [U-2H] | 25 mM | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | entity_2 | natural abundance | 2 mM | |
6 | H2O | natural abundance | 90 % |
Bruker DRX - 600 MHz Equipped with a 1H/13C/15N TXI Cryoprobe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 2 mM | |
2 | MES | [U-2H] | 25 mM | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | entity_2 | natural abundance | 2 mM | |
6 | H2O | natural abundance | 90 % |
Bruker DRX - 600 MHz Equipped with a 1H/13C/15N TXI Cryoprobe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 2 mM | |
2 | MES | [U-2H] | 25 mM | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | entity_2 | natural abundance | 2 mM | |
6 | H2O | natural abundance | 90 % |
Bruker DRX - 600 MHz Equipped with a 1H/13C/15N TXI Cryoprobe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_2 | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | MES | [U-2H] | 25 mM | |
9 | sodium azide | natural abundance | 0.02 % | |
10 | D2O | [U-99% 2H] | 10 % | |
11 | entity_1 | natural abundance | 2 mM | |
12 | H2O | [U-99% 2H] | 90 % |
Bruker DRX - 600 MHz Equipped with a 1H/13C/15N TXI Cryoprobe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_2 | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | MES | [U-2H] | 25 mM | |
9 | sodium azide | natural abundance | 0.02 % | |
10 | D2O | [U-99% 2H] | 10 % | |
11 | entity_1 | natural abundance | 2 mM | |
12 | H2O | [U-99% 2H] | 90 % |
Bruker DRX - 600 MHz Equipped with a 1H/13C/15N TXI Cryoprobe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_2 | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | MES | [U-2H] | 25 mM | |
9 | sodium azide | natural abundance | 0.02 % | |
10 | D2O | [U-99% 2H] | 10 % | |
11 | entity_1 | natural abundance | 2 mM | |
12 | H2O | [U-99% 2H] | 90 % |
Bruker DRX - 600 MHz Equipped with a 1H/13C/15N TXI Cryoprobe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 2 mM | |
2 | MES | [U-2H] | 25 mM | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | entity_2 | natural abundance | 2 mM | |
6 | H2O | natural abundance | 90 % |
Bruker DRX - 600 MHz Equipped with a 1H/13C/15N TXI Cryoprobe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_2 | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | MES | [U-2H] | 25 mM | |
9 | sodium azide | natural abundance | 0.02 % | |
10 | D2O | [U-99% 2H] | 10 % | |
11 | entity_1 | natural abundance | 2 mM | |
12 | H2O | [U-99% 2H] | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25694_2n55.nef |
Input source #2: Coordindates | 2n55.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:9:CYS:SG | A:34:CYS:SG | oxidized, CA 53.127, CB 40.218 ppm | oxidized, CA 54.81, CB 44.1 ppm | 2.027 |
A:11:CYS:SG | A:50:CYS:SG | oxidized, CA 53.429, CB 39.279 ppm | oxidized, CA 56.428, CB 45.27 ppm | 2.015 |
A:55:CYS:SG | A:58:CYS:SG | oxidized, CA 57.075, CB 41.544 ppm | oxidized, CA 64.835, CB 36.367 ppm | 2.028 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60-------- GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK --------10--------20--------30--------40--------50--------60--------70
-200-----210-------220-------230-------- GSMEGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK |||||||||||||||||||||||||||||||||||||||| GSMEGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK --------10--------20--------30--------40
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 70 | 0 | 0 | 100.0 |
B | B | 40 | 0 | 0 | 100.0 |
Content subtype: combined_25694_2n55.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60-------- GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK
-200-----210-------220-------230-------- GSMEGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK |||||||||||||||||||||||||||||||||||||||| GSMEGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 457 | 446 | 97.6 |
13C chemical shifts | 327 | 303 | 92.7 |
15N chemical shifts | 82 | 73 | 89.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 137 | 133 | 97.1 |
13C chemical shifts | 140 | 132 | 94.3 |
15N chemical shifts | 66 | 62 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 320 | 313 | 97.8 |
13C chemical shifts | 187 | 171 | 91.4 |
15N chemical shifts | 16 | 11 | 68.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 37 | 100.0 |
13C chemical shifts | 37 | 31 | 83.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 26 | 92.9 |
13C chemical shifts | 27 | 17 | 63.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 231 | 215 | 93.1 |
13C chemical shifts | 168 | 149 | 88.7 |
15N chemical shifts | 44 | 37 | 84.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 83 | 81 | 97.6 |
13C chemical shifts | 80 | 77 | 96.3 |
15N chemical shifts | 39 | 37 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 148 | 134 | 90.5 |
13C chemical shifts | 88 | 72 | 81.8 |
15N chemical shifts | 5 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 11 | 9 | 81.8 |
13C chemical shifts | 11 | 9 | 81.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 20 | 90.9 |
13C chemical shifts | 22 | 10 | 45.5 |
Covalent bonds
Distance restraints
-0--------10--------20--------30--------40--------50--------60-------- GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK ||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..KPVSLSYRCPC.FFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK
-200-----210-------220-------230-------- GSMEGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK |||||||||||||||||||||||||||||||| |||| ...EGISIYTSDNYTEEMGSGDYDSMKEPAFREEN.NFNK
-0--------10--------20--------30--------40--------50--------60-------- GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK
-200-----210-------220-------230-------- GSMEGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK ||||||||||||||||||||||||||||||||||||| ...EGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK
Dihedral angle restraints
-0--------10--------20--------30--------40--------50--------60-------- GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........RCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALN -0--------10--------20--------30--------40--------50--------60-------
-200-----210-------220-------230-------- GSMEGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK |||||| ||||| ||||| ||| || .......IYTSDN.TEEMG.GDYDS.KEP...EE -200-----210-------220-------230--
-0--------10--------20--------30--------40--------50--------60-------- GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........RCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALN -0--------10--------20--------30--------40--------50--------60-------