The selective autophagy receptor TAX1BP1 is required for autophagy-dependent capture of cytosolic Salmonella typhimurium
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.7 % (655 of 783) | 97.1 % (401 of 413) | 63.0 % (191 of 303) | 94.0 % (63 of 67) |
Backbone | 94.1 % (350 of 372) | 94.3 % (116 of 123) | 94.2 % (180 of 191) | 93.1 % (54 of 58) |
Sidechain | 77.0 % (365 of 474) | 98.3 % (285 of 290) | 40.6 % (71 of 175) | 100.0 % (9 of 9) |
Aromatic | 53.7 % (58 of 108) | 100.0 % (54 of 54) | 5.7 % (3 of 53) | 100.0 % (1 of 1) |
Methyl | 56.7 % (17 of 30) | 100.0 % (15 of 15) | 13.3 % (2 of 15) |
1. TAXBP1
GSSFDVHKKC PLCELMFPPN YDQSKFEEHV ESHWKVCPMC SEQFPPDYDQ QVFERHVQTH FDQNSolvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | Liquid NH3 | NH3 | 0.0 ppm | external | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | Liquid NH3 | NH3 | 0.0 ppm | external | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | Liquid NH3 | NH3 | 0.0 ppm | external | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | Liquid NH3 | NH3 | 0.0 ppm | external | indirect | 1.0 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAXBP1 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25735_5aas.nef |
Input source #2: Coordindates | 5aas.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
2:1:ZN:ZN | 1:33:HIS:NE2 | unknown | unknown | n/a |
2:1:ZN:ZN | 1:29:HIS:NE2 | unknown | unknown | n/a |
2:1:ZN:ZN | 1:10:CYS:SG | unknown | unknown | n/a |
2:1:ZN:ZN | 1:13:CYS:SG | unknown | unknown | n/a |
2:2:ZN:ZN | 1:60:HIS:NE2 | unknown | unknown | n/a |
2:2:ZN:ZN | 1:37:CYS:SG | unknown | unknown | n/a |
2:2:ZN:ZN | 1:56:HIS:NE2 | unknown | unknown | n/a |
2:2:ZN:ZN | 1:40:CYS:SG | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
B | 2 | ZN | ZINC ION | None |
Sequence alignments
-------730-------740-------750-------760-------770-------780---- GSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN --------10--------20--------30--------40--------50--------60----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 64 | 0 | 0 | 100.0 |
Content subtype: combined_25735_5aas.nef
Assigned chemical shifts
-------730-------740-------750-------760-------770-------780---- GSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...FDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
752 | SER | HG | 5.812 |
779 | THR | HG1 | 5.186 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 413 | 400 | 96.9 |
13C chemical shifts | 303 | 179 | 59.1 |
15N chemical shifts | 68 | 63 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 123 | 116 | 94.3 |
13C chemical shifts | 128 | 119 | 93.0 |
15N chemical shifts | 58 | 54 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 290 | 284 | 97.9 |
13C chemical shifts | 175 | 60 | 34.3 |
15N chemical shifts | 10 | 9 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 17 | 100.0 |
13C chemical shifts | 17 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 53 | 98.1 |
13C chemical shifts | 53 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
-------730-------740-------750-------760-------770-------780---- GSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...FDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN
Dihedral angle restraints
-------730-------740-------750-------760-------770-------780---- GSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN ||||||||||||||||||||||||||||||||||| |||||||||||||||||||||| .....VHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMC.EQFPPDYDQQVFERHVQTHFDQ -------730-------740-------750-------760-------770-------780---