BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	89.7 % (935 of 1042)	90.5 % (494 of 546)	87.9 % (355 of 404)	93.5 % (86 of 92)
Backbone	89.4 % (490 of 548)	89.9 % (170 of 189)	88.3 % (241 of 273)	91.9 % (79 of 86)
Sidechain	88.8 % (514 of 579)	89.6 % (320 of 357)	87.0 % (188 of 216)	100.0 % (6 of 6)
Aromatic	60.9 % (28 of 46)	65.2 % (15 of 23)	59.1 % (13 of 22)	0.0 % (0 of 1)
Methyl	100.0 % (84 of 84)	100.0 % (42 of 42)	100.0 % (42 of 42)

1. Cdc37

GHMGPGGLDP VEVYESLPEE LQKCFDVKDV QMLQDAISKM DPTDAKYHMQ RCIDSGLWVP NSKASEAKEG EEAGPGDPLL EAVPKTGDEK DVSV

Show sample condition

Sample #1

Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

Sample #2

Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
7	Cdc37	[U-100% 15N]	0.3 ~ 0.5 mM
8	sodium chloride	natural abundance	100 mM
9	HEPES	natural abundance	50 mM
10	D2O	[U-2H]	7 %
11	H2O	natural abundance	93 %
12	DTT	natural abundance	2 mM

Sample #3

Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
13	Cdc37	[U-10% 13C; U-100% 15N]	0.3 ~ 0.5 mM
14	sodium chloride	natural abundance	100 mM
15	HEPES	natural abundance	5 mM
16	D2O	[U-2H]	7 %
17	H2O	natural abundance	93 %
18	DTT	natural abundance	2 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹H	DSS	methyl protons	0.0 ppm	internal	direct	1.0

Referencing offset: -0.17 ppm, Outliers: 2 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹H	DSS	methyl protons	0.0 ppm	internal	direct	1.0

Referencing offset: -0.17 ppm, Outliers: 2 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹H	DSS	methyl protons	0.0 ppm	internal	direct	1.0

Referencing offset: 0.02 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹H	DSS	methyl protons	0.0 ppm	internal	direct	1.0

Referencing offset: -0.04 ppm, Outliers: 2 Detail

Protein Blocks Logo

Calculated from 10 models in PDB: 2N5X, Strand ID: A Detail

Release date

2015-10-04

Citation

The C-terminal domain of human Cdc37 studied by solution NMR
Zhang, Z., Keramisanou, D., Dudhat, A., Pare, M., Gelis, I.
J. Biomol. NMR (2015), 63, 315-321, PubMed 26400850 , DOI 10.1007/s10858-015-9988-6 , Abstract

Related entities 1. C-terminal domain of Cdc37 cochaperone, : 1 : 13 entities Detail

Interaction partners 1. C-terminal domain of Cdc37 cochaperone, : 258 interactors Detail

More details for 258 interactors identified by 35 citations

Experiments performed 14 experiments Detail

1 3D HNCA

Instrument

Varian VNMRS - 600 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

2 3D HN(CO)CA

Instrument

Varian VNMRS - 600 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

3 3D HNCACB

Instrument

Varian VNMRS - 600 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

4 3D CBCA(CO)NH

Instrument

Varian VNMRS - 600 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

5 2D 1H-15N HSQC

Instrument

Varian VNMRS - 800 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
7	Cdc37	[U-100% 15N]	0.3 ~ 0.5 mM
8	sodium chloride	natural abundance	100 mM
9	HEPES	natural abundance	50 mM
10	D2O	[U-2H]	7 %
11	H2O	natural abundance	93 %
12	DTT	natural abundance	2 mM

6 2D 1H-13C HSQC

Instrument

Varian VNMRS - 600 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

7 2D 1H-13C HSQC aliphatic

Instrument

Varian VNMRS - 800 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
13	Cdc37	[U-10% 13C; U-100% 15N]	0.3 ~ 0.5 mM
14	sodium chloride	natural abundance	100 mM
15	HEPES	natural abundance	5 mM
16	D2O	[U-2H]	7 %
17	H2O	natural abundance	93 %
18	DTT	natural abundance	2 mM

8 3D H(CCO)NH

Instrument

Varian VNMRS - 800 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

9 3D C(CO)NH

Instrument

Varian VNMRS - 800 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

10 3D 1H-15N NOESY

Instrument

Varian VNMRS - 800 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
7	Cdc37	[U-100% 15N]	0.3 ~ 0.5 mM
8	sodium chloride	natural abundance	100 mM
9	HEPES	natural abundance	50 mM
10	D2O	[U-2H]	7 %
11	H2O	natural abundance	93 %
12	DTT	natural abundance	2 mM

11 3D 1H-13C NOESY aliphatic

Instrument

Varian VNMRS - 800 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

12 2D 1H-13C HSQC aromatic

Instrument

Varian VNMRS - 800 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

13 2D 1H-15N HSQC

Instrument

Varian VNMRS - 800 MHz

Sample

State anisotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
7	Cdc37	[U-100% 15N]	0.3 ~ 0.5 mM
8	sodium chloride	natural abundance	100 mM
9	HEPES	natural abundance	50 mM
10	D2O	[U-2H]	7 %
11	H2O	natural abundance	93 %
12	DTT	natural abundance	2 mM

14 3D HNCO

Instrument

Varian VNMRS - 600 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 50mM Hepes, pH=7.5, 100mM NaCl, 2mM DTT

#	Name	Isotope labeling	Concentration
1	Cdc37	[U-100% 13C; U-100% 15N]	0.3 ~ 0.5 mM
2	sodium chloride	natural abundance	100 mM
3	HEPES	natural abundance	50 mM
4	D2O	[U-100% 2H]	7 %
5	H2O	natural abundance	93 %
6	DTT	natural abundance	2 mM

NMR combined restraints 6 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints	combined_25740_2n5x.nef
Input source #2: Coordindates	2n5x.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

---290-------300-------310-------320-------330-------340-------350-------360-------370--------
GHMGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GHMGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV
--------10--------20--------30--------40--------50--------60--------70--------80--------90----

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	94	0	0	100.0

Content subtype: combined_25740_2n5x.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	932		95.7 (chain: A, length: 94)
1	Distance restraints	DYANA/DIANA_distance_constraints_5	Warning	1341 (1)	noe	85.1 (chain: A, length: 94)
2	Distance restraints	DYANA/DIANA_distance_constraints_4	Warning	88 (1)	hbond	38.3 (chain: A, length: 94)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_2	Warning	90 (86)	.	61.7 (chain: A, length: 94)
1	RDC restraints	DYANA/DIANA_dipolar_coupling_3	OK	58 (58)	.	61.7 (chain: A, length: 94)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 94, Sequence coverage: 95.7%
- Total number of assignments
  - ¹H chemical shifts: 495
  - ¹³C chemical shifts: 351
  - ¹⁵N chemical shifts: 86
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	546	495	90.7
¹³C chemical shifts	404	351	86.9
¹⁵N chemical shifts	93	86	92.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	189	174	92.1
¹³C chemical shifts	188	163	86.7
¹⁵N chemical shifts	86	80	93.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	357	321	89.9
¹³C chemical shifts	216	188	87.0
¹⁵N chemical shifts	7	6	85.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	46	44	95.7
¹³C chemical shifts	46	44	95.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	23	15	65.2
¹³C chemical shifts	22	13	59.1
¹⁵N chemical shifts	1	1	100.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_5
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 94, Sequence coverage: 85.1%
- Total number of restraints: 1341
- Weight of restraints: 1.0 (1341)
- Potential type of restraints: upper-bound-parabolic (1341)
- Range of distance target values: 2.47, 5.5 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_4
  - Status: Warning
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 94, Sequence coverage: 38.3%
  - Total number of restraints: 88
  - Weight of restraints: 1.0 (88)
  - Potential type of restraints: upper-bound-parabolic (88)
  - Range of distance target values: 1.8, 3.0 (Å)
  - Histogram of distance target values
  - Histogram of discrepancy in distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_2
- Status: Warning
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 94, Sequence coverage: 61.7%
- Total number of restraints: 86
- Total number of restraints per polymer type: 86
- Weight of restraints: 1.0 (86)
- Potential type of restraints: square-well-parabolic (86)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

RDC restraints

Saveframe: DYANA/DIANA_dipolar_coupling_3

Status: OK
Experiment type: .

Sequence coverage of experimental data

Entity_assembly_ID: A, Chain length: 94, Sequence coverage: 61.7%

---290-------300-------310-------320-------330-------340-------350-------360-------370--------
GHMGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV
   | ||||  |||||| || |  |||| ||||| || | | ||| |||||| ||| ||     | | || ||| || ||||   |||    | 
...G.GGLD..EVYESL.EE.Q..FDVK.VQMLQ.AI.K.D.TDA.YHMQRC.DSG.WV.....S.A.EG.EAG.GD.LLEA...TGD....S 
---290-------300-------310-------320-------330-------340-------350-------360-------370-------

Total number of restraints: 58
Potential type of restraints: undefined (58)
Range of observed RDC values: 100.0, -100.0 (Hz)
RDC restraints per residue
- Chain_ID: A
  None

Keywords Hsp90, cdc37, co-chaperone, kinase

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (3.14 seconds)

BMRB: 25740

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. C-terminal domain of Cdc37 cochaperone, : 1 : 13 entities Detail

Interaction partners 1. C-terminal domain of Cdc37 cochaperone, : 258 interactors Detail

Experiments performed 14 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 6 contents Detail