NMR structure of the Vta1NTD-Did2(176-204) complex
MASNAARVVA TAKDFDKVGL GIIGYYLQLY AVELILSEED RSQEMTALAT ELLDTIEAFK KEIGGESEAE DSDKSLHVMN TLIHDQEKAK IYMLNFTMSL YNEKLKQLKD GPWDVMLKRS LWCCIDLFSC ILHLWKENIS ETSTNSLQKR IKYCKIYLSK LAKGEIG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.2 % (1948 of 2341) | 86.2 % (1052 of 1221) | 78.1 % (710 of 909) | 88.2 % (186 of 211) |
Backbone | 92.7 % (1086 of 1172) | 92.7 % (370 of 399) | 92.7 % (537 of 579) | 92.3 % (179 of 194) |
Sidechain | 76.6 % (1039 of 1356) | 83.0 % (682 of 822) | 67.7 % (350 of 517) | 41.2 % (7 of 17) |
Aromatic | 38.2 % (55 of 144) | 72.2 % (52 of 72) | 0.0 % (0 of 69) | 100.0 % (3 of 3) |
Methyl | 92.4 % (220 of 238) | 97.5 % (116 of 119) | 87.4 % (104 of 119) |
1. entity 1
MASNAARVVA TAKDFDKVGL GIIGYYLQLY AVELILSEED RSQEMTALAT ELLDTIEAFK KEIGGESEAE DSDKSLHVMN TLIHDQEKAK IYMLNFTMSL YNEKLKQLKD GPWDVMLKRS LWCCIDLFSC ILHLWKENIS ETSTNSLQKR IKYCKIYLSK LAKGEIG2. entity 2
NVPEIKAKEV NVDDEKEDKL AQRLRALRGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5 mM uniformly labeled 15N-/13C-labeled Did2176-204 in complex with 1.8 mM unlabeled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | natural abundance | 1.8 mM | |
10 | entity_2 | [U-13C; U-15N] | 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | [U-100% 2H] | 5 mM | |
14 | D2O | [U-100% 2H] | 10 % | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5 mM uniformly labeled 15N-/13C-labeled Did2176-204 in complex with 1.8 mM unlabeled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | natural abundance | 1.8 mM | |
10 | entity_2 | [U-13C; U-15N] | 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | [U-100% 2H] | 5 mM | |
14 | D2O | [U-100% 2H] | 10 % | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5 mM uniformly labeled 15N-/13C-labeled Did2176-204 in complex with 1.8 mM unlabeled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | natural abundance | 1.8 mM | |
10 | entity_2 | [U-13C; U-15N] | 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | [U-100% 2H] | 5 mM | |
14 | D2O | [U-100% 2H] | 10 % | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5 mM uniformly labeled 15N-/13C-labeled Did2176-204 in complex with 1.8 mM unlabeled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | natural abundance | 1.8 mM | |
10 | entity_2 | [U-13C; U-15N] | 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | [U-100% 2H] | 5 mM | |
14 | D2O | [U-100% 2H] | 10 % | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5 mM uniformly labeled 15N-/13C-labeled Did2176-204 in complex with 1.8 mM unlabeled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | natural abundance | 1.8 mM | |
10 | entity_2 | [U-13C; U-15N] | 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | [U-100% 2H] | 5 mM | |
14 | D2O | [U-100% 2H] | 10 % | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5mM uniformly 15N-/13C double labeled or 15N-/13C-/70% 2H triple labeled Vta1NTD plus 1.8 mM unlabeled Did2176-204
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 1.5 mM | |
2 | entity_1 | [U-13C; U-15N; U-70% 2H] | 1.5 mM | |
3 | entity_2 | natural abundance | 1.8 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DTT | [U-100% 2H] | 5 mM | |
7 | D2O | [U-100% 2H] | 10 % | |
8 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0, Details 1.5 mM uniformly labeled 15N-/13C-labeled Did2176-204 in complex with 1.8 mM unlabeled Vta1NTD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | natural abundance | 1.8 mM | |
10 | entity_2 | [U-13C; U-15N] | 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | [U-100% 2H] | 5 mM | |
14 | D2O | [U-100% 2H] | 10 % | |
15 | sodium azide | natural abundance | 0.02 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr25767_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSL -------110-------120-------130-------140-------150-------160------- YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG
--------10--------20--------- NVPEIKAKEVNVDDEKEDKLAQRLRALRG ||||||||||||||||||||||||||||| NVPEIKAKEVNVDDEKEDKLAQRLRALRG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
7 | ARG | HH11 | 7.121 |
7 | ARG | HH12 | 7.121 |
17 | LYS | HZ1 | 7.116 |
17 | LYS | HZ2 | 7.116 |
17 | LYS | HZ3 | 7.116 |
41 | ARG | HH11 | 7.154 |
41 | ARG | HH12 | 7.154 |
50 | THR | HG1 | 5.441 |
77 | HIS | HD1 | 7.059 |
123 | CYS | HG | 2.03 |
155 | LYS | HZ1 | 7.532 |
155 | LYS | HZ2 | 7.532 |
155 | LYS | HZ3 | 7.532 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1036 | 918 | 88.6 |
13C chemical shifts | 780 | 595 | 76.3 |
15N chemical shifts | 184 | 164 | 89.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 341 | 328 | 96.2 |
13C chemical shifts | 334 | 310 | 92.8 |
15N chemical shifts | 166 | 157 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 695 | 590 | 84.9 |
13C chemical shifts | 446 | 285 | 63.9 |
15N chemical shifts | 18 | 7 | 38.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 108 | 103 | 95.4 |
13C chemical shifts | 108 | 83 | 76.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 52 | 72.2 |
13C chemical shifts | 69 | 0 | 0.0 |
15N chemical shifts | 3 | 3 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 185 | 133 | 71.9 |
13C chemical shifts | 129 | 93 | 72.1 |
15N chemical shifts | 34 | 21 | 61.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 45 | 77.6 |
13C chemical shifts | 58 | 46 | 79.3 |
15N chemical shifts | 28 | 21 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 127 | 88 | 69.3 |
13C chemical shifts | 71 | 47 | 66.2 |
15N chemical shifts | 6 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 17 | 100.0 |
13C chemical shifts | 17 | 13 | 76.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|