Chemical shift assignments and structure calculation of spider toxin pi-hexatoxin-Hi1a
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS4:SG | 1:CYS19:SG |
2 | disulfide | sing | 1:CYS11:SG | 1:CYS24:SG |
3 | disulfide | sing | 1:CYS18:SG | 1:CYS34:SG |
4 | disulfide | sing | 1:CYS41:SG | 1:CYS56:SG |
5 | disulfide | sing | 1:CYS48:SG | 1:CYS61:SG |
6 | disulfide | sing | 1:CYS55:SG | 1:CYS72:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.1 % (827 of 879) | 96.3 % (448 of 465) | 91.3 % (305 of 334) | 92.5 % (74 of 80) |
Backbone | 91.1 % (410 of 450) | 95.5 % (147 of 154) | 87.9 % (196 of 223) | 91.8 % (67 of 73) |
Sidechain | 97.0 % (485 of 500) | 96.8 % (301 of 311) | 97.3 % (177 of 182) | 100.0 % (7 of 7) |
Aromatic | 98.5 % (67 of 68) | 100.0 % (34 of 34) | 96.8 % (30 of 31) | 100.0 % (3 of 3) |
Methyl | 100.0 % (54 of 54) | 100.0 % (27 of 27) | 100.0 % (27 of 27) |
1. hi1a
SNECIRKWLS CVDRKNDCCE GLECYKRRHS FEVCVPIPGF CLVKWKQCDG RERDCCAGLE CWKRSGNKSS VCAPITSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hi1a | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | D2O | natural abundance | 5 % | |
3 | DSS | natural abundance | 10 uM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | MES | natural abundance | 20 mM | |
6 | H2O | natural abundance | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance II+ - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hi1a | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | D2O | natural abundance | 5 % | |
3 | DSS | natural abundance | 10 uM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | MES | natural abundance | 20 mM | |
6 | H2O | natural abundance | 95 % |
Bruker Avance II+ - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hi1a | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | D2O | natural abundance | 5 % | |
3 | DSS | natural abundance | 10 uM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | MES | natural abundance | 20 mM | |
6 | H2O | natural abundance | 95 % |
Bruker Avance II+ - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hi1a | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | D2O | natural abundance | 5 % | |
3 | DSS | natural abundance | 10 uM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | MES | natural abundance | 20 mM | |
6 | H2O | natural abundance | 95 % |
Bruker Avance II+ - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hi1a | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | D2O | natural abundance | 5 % | |
3 | DSS | natural abundance | 10 uM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | MES | natural abundance | 20 mM | |
6 | H2O | natural abundance | 95 % |
Bruker Avance II+ - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hi1a | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | D2O | natural abundance | 5 % | |
3 | DSS | natural abundance | 10 uM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | MES | natural abundance | 20 mM | |
6 | H2O | natural abundance | 95 % |
Bruker Avance II+ - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hi1a | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | D2O | natural abundance | 5 % | |
3 | DSS | natural abundance | 10 uM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | MES | natural abundance | 20 mM | |
6 | H2O | natural abundance | 95 % |
Bruker Avance II+ - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hi1a | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | D2O | natural abundance | 5 % | |
3 | DSS | natural abundance | 10 uM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | MES | natural abundance | 20 mM | |
6 | H2O | natural abundance | 95 % |
Bruker Avance II+ - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hi1a | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | D2O | natural abundance | 5 % | |
3 | DSS | natural abundance | 10 uM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | MES | natural abundance | 20 mM | |
6 | H2O | natural abundance | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25848_2n8f.nef |
Input source #2: Coordindates | 2n8f.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:4:CYS:SG | A:19:CYS:SG | oxidized, CB 42.301 ppm | oxidized, CA 54.569, CB 40.917 ppm | 1.959 |
A:11:CYS:SG | A:24:CYS:SG | oxidized, CB 44.031 ppm | oxidized, CB 40.295 ppm | 2.065 |
A:18:CYS:SG | A:34:CYS:SG | oxidized, CB 38.887 ppm | oxidized, CA 54.695, CB 39.974 ppm | 1.958 |
A:41:CYS:SG | A:56:CYS:SG | oxidized, CA 53.666, CB 44.109 ppm | oxidized, CA 54.491, CB 41.013 ppm | 1.959 |
A:48:CYS:SG | A:61:CYS:SG | oxidized, CB 43.989 ppm | oxidized, CB 39.474 ppm | 2.11 |
A:55:CYS:SG | A:72:CYS:SG | oxidized, CA 55.989, CB 38.434 ppm | oxidized, CA 54.465, CB 38.458 ppm | 2.072 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70------ SNECIRKWLSCVDRKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNECIRKWLSCVDRKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 76 | 0 | 0 | 100.0 |
Content subtype: combined_25848_2n8f.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------ SNECIRKWLSCVDRKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT |||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNECIRKWLSCV.RKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 465 | 448 | 96.3 |
13C chemical shifts | 334 | 299 | 89.5 |
15N chemical shifts | 87 | 75 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 154 | 147 | 95.5 |
13C chemical shifts | 152 | 122 | 80.3 |
15N chemical shifts | 73 | 67 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 311 | 301 | 96.8 |
13C chemical shifts | 182 | 177 | 97.3 |
15N chemical shifts | 14 | 8 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 27 | 27 | 100.0 |
13C chemical shifts | 27 | 27 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 34 | 100.0 |
13C chemical shifts | 31 | 30 | 96.8 |
15N chemical shifts | 3 | 3 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70------ SNECIRKWLSCVDRKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT |||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNECIRKWLSCV.RKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70------ SNECIRKWLSCVDRKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..ECIRKWLSCVDRKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT