Drosha Quad
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 70.7 % (670 of 947) | 60.6 % (303 of 500) | 82.4 % (300 of 364) | 80.7 % (67 of 83) |
Backbone | 87.2 % (417 of 478) | 80.7 % (134 of 166) | 91.1 % (216 of 237) | 89.3 % (67 of 75) |
Sidechain | 59.0 % (320 of 542) | 50.6 % (169 of 334) | 75.5 % (151 of 200) | 0.0 % (0 of 8) |
Aromatic | 10.7 % (6 of 56) | 14.3 % (4 of 28) | 7.1 % (2 of 28) | |
Methyl | 83.3 % (60 of 72) | 75.0 % (27 of 36) | 91.7 % (33 of 36) |
1. entity
GPGNDPISQL QQCCLTLRTE GKEPDIPLYK TLQTVGPSHA RTYTVAVYFK GERIGCGKGP SKKQAKMGAA MDALEKYNFP QMSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.29
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 850 mM | |
2 | cacodylate pH 7.29 | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | beta-mercaptoethanol | natural abundance | 5 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25924_2na2.nef |
Input source #2: Coordindates | 2na2.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80-- GPGNDPISQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGNDPISQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 82 | 0 | 0 | 100.0 |
Content subtype: combined_25924_2na2.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80-- GPGNDPISQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM ||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||| .....PISQLQQCCLTLRTEGKEPDIPLYKTLQTVG..HARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 500 | 298 | 59.6 |
13C chemical shifts | 364 | 298 | 81.9 |
15N chemical shifts | 86 | 67 | 77.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 166 | 134 | 80.7 |
13C chemical shifts | 164 | 149 | 90.9 |
15N chemical shifts | 75 | 67 | 89.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 334 | 164 | 49.1 |
13C chemical shifts | 200 | 149 | 74.5 |
15N chemical shifts | 11 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 29 | 74.4 |
13C chemical shifts | 39 | 34 | 87.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 0 | 0.0 |
13C chemical shifts | 28 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80-- GPGNDPISQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM ||||||||||||||||||||| ||||||||| |||||||||||||||||||||||||||||||||||||||||||| .....PISQLQQCCLTLRTEGKEPDI.LYKTLQTVG..HARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80-- GPGNDPISQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM ||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||| .....PISQLQQCCLTLRTEGKEPDIPLYKTLQTVG..HARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNF --------10--------20--------30--------40--------50--------60--------70---------