Membrane-bound mouse CD28 cytoplasmic tail
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.5 % (506 of 519) | 99.3 % (278 of 280) | 95.4 % (188 of 197) | 95.2 % (40 of 42) |
Backbone | 94.7 % (233 of 246) | 97.6 % (80 of 82) | 92.9 % (118 of 127) | 94.6 % (35 of 37) |
Sidechain | 100.0 % (314 of 314) | 100.0 % (198 of 198) | 100.0 % (111 of 111) | 100.0 % (5 of 5) |
Aromatic | 100.0 % (42 of 42) | 100.0 % (21 of 21) | 100.0 % (21 of 21) | |
Methyl | 100.0 % (26 of 26) | 100.0 % (13 of 13) | 100.0 % (13 of 13) |
1. entity
GTNSRRNRLL QSDYMNMTPR RPGLTRKPYQ PYAPARDFAA YRPSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | protons | 30.219 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.754 ppm | internal | direct | 1.0 |
15N | na | protons | 118.561 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | protons | 30.219 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.754 ppm | internal | direct | 1.0 |
15N | na | protons | 118.561 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | protons | 30.219 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.754 ppm | internal | direct | 1.0 |
15N | na | protons | 118.561 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | protons | 30.219 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.754 ppm | internal | direct | 1.0 |
15N | na | protons | 118.561 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mCD28CD | [U-13C; U-15N] | 0.5 mM | |
2 | POPG | natural abundance | 100 mM | |
3 | DHPC | natural abundance | 125 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | D2O | [U-2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25935_2nae.nef |
Input source #2: Coordindates | 2nae.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--- GTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP ||||||||||||||||||||||||||||||||||||||||||| GTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 43 | 0 | 0 | 100.0 |
Content subtype: combined_25935_2nae.nef
Assigned chemical shifts
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 280 | 278 | 99.3 |
13C chemical shifts | 197 | 188 | 95.4 |
15N chemical shifts | 50 | 48 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 80 | 97.6 |
13C chemical shifts | 86 | 77 | 89.5 |
15N chemical shifts | 37 | 35 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 198 | 198 | 100.0 |
13C chemical shifts | 111 | 111 | 100.0 |
15N chemical shifts | 13 | 13 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 15 | 15 | 100.0 |
13C chemical shifts | 15 | 15 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 21 | 21 | 100.0 |
13C chemical shifts | 21 | 21 | 100.0 |
Distance restraints
--------10--------20--------30--------40--- GTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP |||||||||||||||||||||||||||||||||||||||||| .TNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP