Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Sequence alignments

• Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30---
NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR
|||||||||||||||||||||||||||||||||
NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR

Chain assignments

Content subtype: combined_25939_2naj.nef

Assigned chemical shifts

1. Saveframe: assigned_chem_shift_list_1
   • Status: OK
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 33, Sequence coverage: 100.0%

     --------10--------20--------30---
     NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR
     |||||||||||||||||||||||||||||||||
     NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR
     

   • Total number of assignments
     • ¹H chemical shifts: 180
   • Completeness of assignments
     • Entity_assemble_ID: A
       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	194	180	92.8

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	68	67	98.5

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	126	113	89.7

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	10	10	100.0

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	21	20	95.2

   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: A

Covalent bonds

1. Saveframe: assembly
   • Status: OK

Distance restraints

1. Saveframe: CNS/XPLOR_distance_constraints_3
   • Status: Warning
   • Experiment type: noe
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 33, Sequence coverage: 100.0%

     --------10--------20--------30---
     NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR
     |||||||||||||||||||||||||||||||||
     NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR
     

   • Total number of restraints: 516
     • Intra-residue restraints, i = j : 203
     • Sequential restraints, | i - j | = 1 : 136
       • Backbone-backbone: 57
       • Backbone-side chain: 72
       • Side chain-side chain: 7
     • Medium range restraints, 1 < | i - j | < 5 : 52
       • Backbone-backbone: 14
       • Backbone-side chain: 25
       • Side chain-side chain: 13
     • Long range restraints, | i - j | >= 5 : 125
   • Weight of restraints: 1.0 (516)
     • Intra-residue restraints, i = j : 1.0 (203)
     • Sequential restraints, | i - j | = 1 : 1.0 (136)
       • Backbone-backbone: 1.0 (57)
       • Backbone-side chain: 1.0 (72)
       • Side chain-side chain: 1.0 (7)
     • Medium range restraints, 1 < | i - j | < 5 : 1.0 (52)
       • Backbone-backbone: 1.0 (14)
       • Backbone-side chain: 1.0 (25)
       • Side chain-side chain: 1.0 (13)
     • Long range restraints, | i - j | >= 5 : 1.0 (125)
   • Potential type of restraints: square-well-parabolic (516)
     • Intra-residue restraints, i = j : square-well-parabolic (203)
     • Sequential restraints, | i - j | = 1 : square-well-parabolic (136)
       • Backbone-backbone: square-well-parabolic (57)
       • Backbone-side chain: square-well-parabolic (72)
       • Side chain-side chain: square-well-parabolic (7)
     • Medium range restraints, 1 < | i - j | < 5 : square-well-parabolic (52)
       • Backbone-backbone: square-well-parabolic (14)
       • Backbone-side chain: square-well-parabolic (25)
       • Side chain-side chain: square-well-parabolic (13)
     • Long range restraints, | i - j | >= 5 : square-well-parabolic (125)
   • Range of distance target values: 1.46, 2.75 (Å)
   • Histogram of distance target values
   • Histogram of discrepancy in distance target values
   • Distance restraints per residue
     • Chain_ID: A
   • Distance restraints on contact map
     • Chain_ID_1: A - Chain_ID_2: A

Dihedral angle restraints

1. Saveframe: CNS/XPLOR_dihedral_2
   • Status: OK
   • Experiment type: .
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 33, Sequence coverage: 30.3%
   • Total number of restraints: 6
     • Phi angle constraints: 6
   • Total number of restraints per polymer type: 6
     • Protein: 6
   • Weight of restraints: 1.0 (6)
     • Phi angle constraints: 1.0 (6)
   • Potential type of restraints: square-well-parabolic (6)
     • Phi angle constraints: square-well-parabolic (6)
   • Dihedral angle restraints per residue