Identification and structural characterization of LytU
GSKWEDFFRG SRITETFGKY QHSPFDGKHY GIDFALPKGT PIKAPTNGKV TRIFNNELGG KVLQIAEDNG EYHQWYLHLD KYNVKVGDRV KAGDIIAYSG NTGIQTTGAH LHFQRMKGGV GNAYAEDPKP FIDQLPDGER SLYDL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.2 % (1467 of 1701) | 93.3 % (828 of 887) | 75.5 % (499 of 661) | 91.5 % (140 of 153) |
Backbone | 81.4 % (697 of 856) | 93.7 % (283 of 302) | 69.0 % (287 of 416) | 92.0 % (127 of 138) |
Sidechain | 92.0 % (893 of 971) | 93.2 % (545 of 585) | 90.3 % (335 of 371) | 86.7 % (13 of 15) |
Aromatic | 79.7 % (153 of 192) | 83.3 % (80 of 96) | 75.5 % (71 of 94) | 100.0 % (2 of 2) |
Methyl | 98.4 % (126 of 128) | 98.4 % (63 of 64) | 98.4 % (63 of 64) |
1. LytU
GSKWEDFFRG SRITETFGKY QHSPFDGKHY GIDFALPKGT PIKAPTNGKV TRIFNNELGG KVLQIAEDNG EYHQWYLHLD KYNVKVGDRV KAGDIIAYSG NTGIQTTGAH LHFQRMKGGV GNAYAEDPKP FIDQLPDGER SLYDLSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | Bis-Tris | natural abundance | 20 mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr26853_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSKWEDFFRGSRITETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSG |||||||||||||||| ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SKWEDFFRGSRITETF..YQHSP.DGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSG -------110-------120-------130-------140----- NTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFIDQLPDGERSLYDL ||||||||||||||||||||||||||||||||||||||||||||| NTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFIDQLPDGERSLYDL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 887 | 805 | 90.8 |
13C chemical shifts | 661 | 467 | 70.7 |
15N chemical shifts | 159 | 136 | 85.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 302 | 278 | 92.1 |
13C chemical shifts | 290 | 139 | 47.9 |
15N chemical shifts | 138 | 123 | 89.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 585 | 527 | 90.1 |
13C chemical shifts | 371 | 328 | 88.4 |
15N chemical shifts | 21 | 13 | 61.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 64 | 98.5 |
13C chemical shifts | 65 | 64 | 98.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 78 | 81.2 |
13C chemical shifts | 94 | 67 | 71.3 |
15N chemical shifts | 2 | 2 | 100.0 |