The 15N, 13C and 1H Chemical Shift Assignment of Sis1 J domain from S. cerevisiae
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.9 % (826 of 985) | 81.2 % (423 of 521) | 86.6 % (330 of 381) | 88.0 % (73 of 83) |
Backbone | 91.3 % (449 of 492) | 87.1 % (148 of 170) | 94.3 % (230 of 244) | 91.0 % (71 of 78) |
Sidechain | 79.1 % (450 of 569) | 78.3 % (275 of 351) | 81.2 % (173 of 213) | 40.0 % (2 of 5) |
Aromatic | 59.5 % (44 of 74) | 70.3 % (26 of 37) | 48.6 % (18 of 37) | |
Methyl | 89.7 % (61 of 68) | 88.2 % (30 of 34) | 91.2 % (31 of 34) |
1. Sis1 J-domain
GMTSVKETKL YDLLGVSPSA NEQELKKGYR KAALKYHPDK PTGDTEKFKE ISEAFEILND PQKREIYDQY GLEAARSGGP SFGPSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance III - 600 MHz TCI cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details 250 uM Sis1 J-domain in 25 mM Tris-HCl pH 7.5, 200 mM NaCl and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sis1 J-domain | 250 uM | ||
2 | TRIS HCl | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr27405_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80---- GMTSVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAARSGGPSFGP |||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||| ...SVKETKLYDLLGVSPSANEQELKKGYRKAALKYH.DKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAARSGGPSFG --------10--------20--------30--------40--------50--------60--------70--------80---
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 381 | 323 | 84.8 |
1H chemical shifts | 521 | 407 | 78.1 |
15N chemical shifts | 86 | 73 | 84.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 168 | 156 | 92.9 |
1H chemical shifts | 170 | 147 | 86.5 |
15N chemical shifts | 78 | 71 | 91.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 213 | 167 | 78.4 |
1H chemical shifts | 351 | 260 | 74.1 |
15N chemical shifts | 8 | 2 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 35 | 31 | 88.6 |
1H chemical shifts | 35 | 30 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 37 | 16 | 43.2 |
1H chemical shifts | 37 | 26 | 70.3 |