Solution structure of the cross-linked dimer of the SLy1 SAM domain S320C mutant
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS68:SG | 1:CYS68:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.8 % (800 of 810) | 98.8 % (415 of 420) | 98.4 % (313 of 318) | 100.0 % (72 of 72) |
Backbone | 99.5 % (408 of 410) | 100.0 % (140 of 140) | 99.0 % (201 of 203) | 100.0 % (67 of 67) |
Sidechain | 98.3 % (457 of 465) | 98.2 % (275 of 280) | 98.3 % (177 of 180) | 100.0 % (5 of 5) |
Aromatic | 100.0 % (42 of 42) | 100.0 % (21 of 21) | 100.0 % (21 of 21) | |
Methyl | 97.8 % (90 of 92) | 97.8 % (45 of 46) | 97.8 % (45 of 46) |
1. Sly1 SAM
GPKTLHELLE RIGLEEHTST LLLNGYQTLE DFKELRETHL NELNIMDPQH RAKLLTAAEL LLDYDTGCESolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Sly1 SAM | [U-13C; U-15N] | 0.8 mM | |
7 | potassium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 20 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | sodium azide | natural abundance | 0.03 % | |
11 | Sly1 SAM | natural abundance | 0.8 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sly1 SAM | [U-13C; U-15N] | 1.4 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | sodium azide | natural abundance | 0.03 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Sly1 SAM | [U-13C; U-15N] | 0.8 mM | |
7 | potassium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 20 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | sodium azide | natural abundance | 0.03 % | |
11 | Sly1 SAM | natural abundance | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Sly1 SAM | [U-13C; U-15N] | 0.8 mM | |
7 | potassium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 20 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | sodium azide | natural abundance | 0.03 % | |
11 | Sly1 SAM | natural abundance | 0.8 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_27432_6g8o.nef |
Input source #2: Coordindates | 6g8o.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:68:CYS:SG | B:68:CYS:SG | oxidized, CA 55.5, CB 40.978 ppm | unknown | 2.029 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------- GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE
--------10--------20--------30--------40--------50--------60--------- GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 69 | 0 | 0 | 100.0 |
B | B | 69 | 0 | 0 | 100.0 |
Content subtype: combined_27432_6g8o.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------- GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
24 | ASN | CG | 178.335 |
27 | GLN | CD | 179.982 |
41 | ASN | CG | 176.3 |
44 | ASN | CG | 178.093 |
49 | GLN | CD | 179.523 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 420 | 412 | 98.1 |
13C chemical shifts | 318 | 311 | 97.8 |
15N chemical shifts | 75 | 72 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 140 | 137 | 97.9 |
13C chemical shifts | 138 | 134 | 97.1 |
15N chemical shifts | 67 | 66 | 98.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 280 | 275 | 98.2 |
13C chemical shifts | 180 | 177 | 98.3 |
15N chemical shifts | 8 | 6 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 46 | 97.9 |
13C chemical shifts | 47 | 46 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 21 | 21 | 100.0 |
13C chemical shifts | 21 | 21 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------- GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE
--------10--------20--------30--------40--------50--------60--------- GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------- GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | .PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYD..C --------10--------20--------30--------40--------50--------60--------