Backbone 1H, 13C, and 15N Chemical Shift Assignments for residues 1-136 of yeast Rpn5.
MSRDAPIKAD KDYSQILKEE FPKIDSLAQN DCNSALDQLL VLEKKTRQAS DLASSKEVLA KIVDLLASRN KWDDLNEQLT LLSKKHGQLK LSIQYMIQKV MEYLKSSKSL DLNTRISVIE TIRVVTENKI FVEVER
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.0 % (1434 of 1649) | 83.5 % (723 of 866) | 89.4 % (567 of 634) | 96.6 % (144 of 149) |
Backbone | 98.0 % (796 of 812) | 98.2 % (266 of 271) | 97.8 % (398 of 407) | 98.5 % (132 of 134) |
Sidechain | 79.2 % (770 of 972) | 76.8 % (457 of 595) | 83.1 % (301 of 362) | 80.0 % (12 of 15) |
Aromatic | 18.3 % (11 of 60) | 20.0 % (6 of 30) | 13.8 % (4 of 29) | 100.0 % (1 of 1) |
Methyl | 86.5 % (154 of 178) | 86.5 % (77 of 89) | 86.5 % (77 of 89) |
1. Rpn5
MSRDAPIKAD KDYSQILKEE FPKIDSLAQN DCNSALDQLL VLEKKTRQAS DLASSKEVLA KIVDLLASRN KWDDLNEQLT LLSKKHGQLK LSIQYMIQKV MEYLKSSKSL DLNTRISVIE TIRVVTENKI FVEVERSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rpn5 | [U-95% 13C; U-95% 15N] | 0.3 mM | |
2 | D2O | [U-99% 2H] | 10 % v/v | |
3 | DSS | natural abundance | 0.1 mg/mL | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium sulfate | natural abundance | 50 mM | |
7 | trifluoroethanol | natural abundance | 2 % v/v | |
8 | sucrose | natural abundance | 5 % w/v |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr27442_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKV ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SRD.PIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKV -------110-------120-------130------ MEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVER |||||||||||||||||||||||||||||||||||| MEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVER
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
8 | LYS | HZ1 | 7.492 |
8 | LYS | HZ2 | 7.492 |
8 | LYS | HZ3 | 7.492 |
115 | ARG | HH21 | 6.67 |
123 | ARG | HH21 | 6.735 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 866 | 707 | 81.6 |
13C chemical shifts | 634 | 557 | 87.9 |
15N chemical shifts | 155 | 144 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 271 | 266 | 98.2 |
13C chemical shifts | 272 | 264 | 97.1 |
15N chemical shifts | 134 | 131 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 595 | 441 | 74.1 |
13C chemical shifts | 362 | 293 | 80.9 |
15N chemical shifts | 21 | 13 | 61.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 92 | 77 | 83.7 |
13C chemical shifts | 92 | 76 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 2 | 6.7 |
13C chemical shifts | 29 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |