Backbone 1H, 13C, and 15N Chemical Shift Assignments for bacteriophage protein Gp46
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.9 % (893 of 931) | 95.5 % (462 of 484) | 96.7 % (355 of 367) | 95.0 % (76 of 80) |
Backbone | 97.4 % (448 of 460) | 96.8 % (152 of 157) | 97.8 % (222 of 227) | 97.4 % (74 of 76) |
Sidechain | 95.0 % (517 of 544) | 94.8 % (310 of 327) | 96.2 % (205 of 213) | 50.0 % (2 of 4) |
Aromatic | 88.6 % (62 of 70) | 88.6 % (31 of 35) | 88.2 % (30 of 34) | 100.0 % (1 of 1) |
Methyl | 100.0 % (92 of 92) | 100.0 % (46 of 46) | 100.0 % (46 of 46) |
1. Gp46
MMTEDQKFKY LTKIEELEAG CFSDWTKEDI TGDLKYLKKG IIEESIELIR AVNGLTYSEE LHDFTQEIIE ELDISPLSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.8 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.8 ppm | internal | indirect | 1.0 |
15N | water | protons | 4.8 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.8 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.8 ppm | internal | indirect | 1.0 |
15N | water | protons | 4.8 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.8 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.8 ppm | internal | indirect | 1.0 |
15N | water | protons | 4.8 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.8 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.8 ppm | internal | indirect | 1.0 |
15N | water | protons | 4.8 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp46 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | TCEP | natural abundance | 1 mM | |
4 | potassium phosphate | natural abundance | 50 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr27767_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------- MMTEDQKFKYLTKIEELEAGCFSDWTKEDITGDLKYLKKGIIEESIELIRAVNGLTYSEELHDFTQEIIEELDISPL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MTEDQKFKYLTKIEELEAGCFSDWTKEDITGDLKYLKKGIIEESIELIRAVNGLTYSEELHDFTQEIIEELDISPL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
62 | HIS | HE2 | 7.498 |
62 | HIS | NE2 | 181.05 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 484 | 465 | 96.1 |
13C chemical shifts | 367 | 355 | 96.7 |
15N chemical shifts | 81 | 75 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 157 | 154 | 98.1 |
13C chemical shifts | 154 | 150 | 97.4 |
15N chemical shifts | 76 | 74 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 327 | 311 | 95.1 |
13C chemical shifts | 213 | 205 | 96.2 |
15N chemical shifts | 5 | 1 | 20.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 46 | 95.8 |
13C chemical shifts | 48 | 46 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 32 | 91.4 |
13C chemical shifts | 34 | 30 | 88.2 |
15N chemical shifts | 1 | 1 | 100.0 |