1H, 13C, and 15N chemical shift assignments of the Gp4 from the Pseudomonas phage LUZ24
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.1 % (587 of 611) | 96.0 % (316 of 329) | 98.2 % (224 of 228) | 87.0 % (47 of 54) |
Backbone | 98.1 % (265 of 270) | 97.8 % (87 of 89) | 99.3 % (137 of 138) | 95.3 % (41 of 43) |
Sidechain | 95.1 % (368 of 387) | 95.4 % (229 of 240) | 97.8 % (133 of 136) | 54.5 % (6 of 11) |
Aromatic | 100.0 % (28 of 28) | 100.0 % (14 of 14) | 100.0 % (13 of 13) | 100.0 % (1 of 1) |
Methyl | 100.0 % (44 of 44) | 100.0 % (22 of 22) | 100.0 % (22 of 22) |
1. Gp4
MKSPYEAAHE RALMVNRLQK LTRMLRVHPD PKWKQEQQEL IKRLKKSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp4 | [U-13C; U-15N] | 1 mM | |
2 | Bis-TRIS | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 6 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr28112_3.str
Assigned chemical shifts
--------10--------20--------30--------40------ MKSPYEAAHERALMVNRLQKLTRMLRVHPDPKWKQEQQELIKRLKK |||||||||||||||||||||||||||||||||||||||||||||| MKSPYEAAHERALMVNRLQKLTRMLRVHPDPKWKQEQQELIKRLKK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
16 | ASN | CG | 175.643 |
19 | GLN | CD | 179.905 |
35 | GLN | CD | 180.002 |
37 | GLN | CD | 178.198 |
38 | GLN | CD | 180.017 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 329 | 316 | 96.0 |
13C chemical shifts | 228 | 224 | 98.2 |
15N chemical shifts | 54 | 47 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 87 | 97.8 |
13C chemical shifts | 92 | 91 | 98.9 |
15N chemical shifts | 43 | 41 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 240 | 229 | 95.4 |
13C chemical shifts | 136 | 133 | 97.8 |
15N chemical shifts | 11 | 6 | 54.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 25 | 25 | 100.0 |
13C chemical shifts | 25 | 25 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 14 | 100.0 |
13C chemical shifts | 13 | 13 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |