NMR structure of the HLTF HIRAN domain
GSDEEVDSVL FGSLRGHVVG LRYYTGVVNN NEMVALQRDP NNPYDKNAIK VNNVNGNQVG HLKKELAGAL AYIMDNKLAQ IEGVVPFGAN NAFTMPLHMT FWGKEENRKA VSDQLKKHGF KL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.1 % (1279 of 1420) | 90.0 % (665 of 739) | 89.2 % (485 of 544) | 94.2 % (129 of 137) |
Backbone | 95.4 % (691 of 724) | 96.4 % (243 of 252) | 94.1 % (333 of 354) | 97.5 % (115 of 118) |
Sidechain | 85.7 % (691 of 806) | 86.7 % (422 of 487) | 85.0 % (255 of 300) | 73.7 % (14 of 19) |
Aromatic | 52.7 % (58 of 110) | 60.0 % (33 of 55) | 44.4 % (24 of 54) | 100.0 % (1 of 1) |
Methyl | 97.0 % (128 of 132) | 95.5 % (63 of 66) | 98.5 % (65 of 66) |
1. entity 1
GSDEEVDSVL FGSLRGHVVG LRYYTGVVNN NEMVALQRDP NNPYDKNAIK VNNVNGNQVG HLKKELAGAL AYIMDNKLAQ IEGVVPFGAN NAFTMPLHMT FWGKEENRKA VSDQLKKHGF KLSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HLTF HIRAN domain | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30098_5k5f.nef |
Input source #2: Coordindates | 5k5f.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
50-------60--------70--------80--------90-------100-------110-------120-------130-------140-------15 GSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------160-------170- FWGKEENRKAVSDQLKKHGFKL |||||||||||||||||||||| FWGKEENRKAVSDQLKKHGFKL -------110-------120--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 122 | 0 | 0 | 100.0 |
Content subtype: combined_30098_5k5f.nef
Assigned chemical shifts
50-------60--------70--------80--------90-------100-------110-------120-------130-------140-------15 GSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMT 0-------160-------170- FWGKEENRKAVSDQLKKHGFKL |||||||||||||||||||||| FWGKEENRKAVSDQLKKHGFKL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 739 | 670 | 90.7 |
13C chemical shifts | 544 | 487 | 89.5 |
15N chemical shifts | 141 | 129 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 252 | 245 | 97.2 |
13C chemical shifts | 244 | 231 | 94.7 |
15N chemical shifts | 118 | 115 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 487 | 425 | 87.3 |
13C chemical shifts | 300 | 256 | 85.3 |
15N chemical shifts | 23 | 14 | 60.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 69 | 98.6 |
13C chemical shifts | 70 | 69 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 33 | 60.0 |
13C chemical shifts | 54 | 24 | 44.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
50-------60--------70--------80--------90-------100-------110-------120-------130-------140-------15 GSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..DEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMT 0-------160-------170- FWGKEENRKAVSDQLKKHGFKL |||||||||||||||||||||| FWGKEENRKAVSDQLKKHGFKL
Dihedral angle restraints
50-------60--------70--------80--------90-------100-------110-------120-------130-------140-------15 GSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMT |||||||||||||| ||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSDEEVDSVLFGSL..HVVGLRYYTGVVN...MVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMT 0-------160-------170- FWGKEENRKAVSDQLKKHGFKL |||||||||||||||||||||| FWGKEENRKAVSDQLKKHGFKL