Recognition and targeting mechanisms by chaperones in flagella assembly and operation
MTSTVEFINR WQRIALLSQS LLELAQRGEW DLLLQQEVSY LQSIETVMEK QTPPGITRSI QDMVAGYIKQ TLDNEQLLKG LLQQRLDELS SLIGQVLFQG PSAGLVPRGS GGIEGMTTRL TRWLTALDNF EAKMALLPAV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 59.9 % (992 of 1655) | 39.4 % (339 of 861) | 80.3 % (513 of 639) | 90.3 % (140 of 155) |
Backbone | 79.3 % (658 of 830) | 50.3 % (144 of 286) | 93.9 % (384 of 409) | 96.3 % (130 of 135) |
Sidechain | 47.9 % (457 of 954) | 33.9 % (195 of 575) | 70.2 % (252 of 359) | 50.0 % (10 of 20) |
Aromatic | 97.6 % (80 of 82) | 97.6 % (40 of 41) | 97.4 % (37 of 38) | 100.0 % (3 of 3) |
Methyl | 92.7 % (178 of 192) | 92.7 % (89 of 96) | 92.7 % (89 of 96) |
1. Flagellar protein FliT,Flagellum-specific ATP synthase
MTSTVEFINR WQRIALLSQS LLELAQRGEW DLLLQQEVSY LQSIETVMEK QTPPGITRSI QDMVAGYIKQ TLDNEQLLKG LLQQRLDELS SLIGQVLFQG PSAGLVPRGS GGIEGMTTRL TRWLTALDNF EAKMALLPAVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W protein, 20 mM potassium phosphate, 100 mM potassium chloride, 5 mM beta-mercaptoethanol, 0.5 mM EDTA, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EDTA | natural abundance | 0.5 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | protein | [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W | 0.5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N; U-99% 2H] protein, 20 mM potassium phosphate, 100 mM potassium chloride, 5 mM beta-mercaptoethanol, 0.5 mM EDTA, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | EDTA | natural abundance | 0.5 mM | |
10 | beta-mercaptoethanol | natural abundance | 5 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | potassium phosphate | natural abundance | 20 mM | |
13 | protein | [U-99% 13C; U-99% 15N; U-99% 2H] | 0.5 mM | |
14 | sodium azide | natural abundance | 0.05 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W protein, 20 mM potassium phosphate, 100 mM potassium chloride, 5 mM beta-mercaptoethanol, 0.5 mM EDTA, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EDTA | natural abundance | 0.5 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | protein | [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W | 0.5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W protein, 20 mM potassium phosphate, 100 mM potassium chloride, 5 mM beta-mercaptoethanol, 0.5 mM EDTA, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EDTA | natural abundance | 0.5 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | protein | [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W | 0.5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N; U-99% 2H] protein, 20 mM potassium phosphate, 100 mM potassium chloride, 5 mM beta-mercaptoethanol, 0.5 mM EDTA, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | EDTA | natural abundance | 0.5 mM | |
10 | beta-mercaptoethanol | natural abundance | 5 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | potassium phosphate | natural abundance | 20 mM | |
13 | protein | [U-99% 13C; U-99% 15N; U-99% 2H] | 0.5 mM | |
14 | sodium azide | natural abundance | 0.05 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W protein, 20 mM potassium phosphate, 100 mM potassium chloride, 5 mM beta-mercaptoethanol, 0.5 mM EDTA, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EDTA | natural abundance | 0.5 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | protein | [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W | 0.5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W protein, 20 mM potassium phosphate, 100 mM potassium chloride, 5 mM beta-mercaptoethanol, 0.5 mM EDTA, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EDTA | natural abundance | 0.5 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | potassium phosphate | natural abundance | 20 mM | |
5 | protein | [U-100% 15N,2H]_[1H,13C]ILVMATFY_[1H]W | 0.5 mM | |
6 | sodium azide | natural abundance | 0.05 % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM [U-99% 13C; U-99% 15N; U-99% 2H] protein, 20 mM potassium phosphate, 100 mM potassium chloride, 5 mM beta-mercaptoethanol, 0.5 mM EDTA, 0.05 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | EDTA | natural abundance | 0.5 mM | |
10 | beta-mercaptoethanol | natural abundance | 5 mM | |
11 | potassium chloride | natural abundance | 100 mM | |
12 | potassium phosphate | natural abundance | 20 mM | |
13 | protein | [U-99% 13C; U-99% 15N; U-99% 2H] | 0.5 mM | |
14 | sodium azide | natural abundance | 0.05 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30127_5kp0.nef |
Input source #2: Coordindates | 5kp0.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-----------1010------1020----- PSAGLVPRGSGGIEGMTTRLTRWLTALDNFEAKMALLPAV |||||||||||||||||||||||||||||||||||||||| PSAGLVPRGSGGIEGMTTRLTRWLTALDNFEAKMALLPAV -------110-------120-------130-------140
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 140 | 0 | 0 | 100.0 |
Content subtype: combined_30127_5kp0.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQG |||||||||||||||||||||||||||||||||||||||||||||||||||| |||| |||||||||||||||||||||||||||||||||||||||||| MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQT.PGIT.SIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQG -------110-----------1010------1020----- PSAGLVPRGSGGIEGMTTRLTRWLTALDNFEAKMALLPAV |||||||||||||||||||||||||||||||||||||||| PSAGLVPRGSGGIEGMTTRLTRWLTALDNFEAKMALLPAV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 861 | 294 | 34.1 |
13C chemical shifts | 639 | 500 | 78.2 |
15N chemical shifts | 163 | 139 | 85.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 286 | 129 | 45.1 |
13C chemical shifts | 280 | 256 | 91.4 |
15N chemical shifts | 135 | 129 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 575 | 165 | 28.7 |
13C chemical shifts | 359 | 244 | 68.0 |
15N chemical shifts | 28 | 10 | 35.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 101 | 93 | 92.1 |
13C chemical shifts | 101 | 93 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 40 | 97.6 |
13C chemical shifts | 38 | 37 | 97.4 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 M..TVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQT..GIT..IQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQ. | ||||||||||||||||||||||||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||||||||||||||| M..TVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQT..GIT..IQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQ. -------110----------1010------1020----- ....LV......IEMTTRLTRWLTALDNFEAKMALL.AV || |||||||||||||||||||||||| || ....LV......IEMTTRLTRWLTALDNFEAKMALL.AV
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 M..TVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQT..GIT..IQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQ. | ||||||||||||||||||||||||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||||||||||||||| M..TVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQT..GIT..IQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQ. -------110----------1010------1020----- ....LV......IEMTTRLTRWLTALDNFEAKMALL.AV || |||||||||||||||||||||||| || ....LV......IEMTTRLTRWLTALDNFEAKMALL.AV
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQG ||||||||||||||||||||||||||| || ||||||||||||||||| |||||||||||||||||||||||||||||||||||||| MTSTVEFINRWQRIALLSQSLLELAQR..WD.LLQQEVSYLQSIETVME.......TRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIG...... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-----------1010------1020----- PSAGLVPRGSGGIEGMTTRLTRWLTALDNFEAKMALLPAV |||||||||||||||||||||||| ............IEGMTTRLTRWLTALDNFEAKMAL -------110-----------1010------1020-
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQG ||||||||||||||||||||||||||| || ||||||||||||||||| |||||||||||||||||||||||||||||||||||||| MTSTVEFINRWQRIALLSQSLLELAQR..WD.LLQQEVSYLQSIETVME.......TRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIG...... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-----------1010------1020----- PSAGLVPRGSGGIEGMTTRLTRWLTALDNFEAKMALLPAV |||||||||||||||||||||||| ............IEGMTTRLTRWLTALDNFEAKMAL -------110-----------1010------1020-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQG ||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||| ..STVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPG..RSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIG...... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-----------1010------1020----- PSAGLVPRGSGGIEGMTTRLTRWLTALDNFEAKMALLPAV |||| ...........GIEG..................................................................................... -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 .................................................................................................... -------210-------220-------230-------240-------250-------260-------270-------280-------290-------300 .................................................................................................... -------310-------320-------330-------340-------350-------360-------370-------380-------390-------400 .................................................................................................... -------410-------420-------430-------440-------450-------460-------470-------480-------490-------500 .................................................................................................... -------510-------520-------530-------540-------550-------560-------570-------580-------590-------600 .................................................................................................... -------610-------620-------630-------640-------650-------660-------670-------680-------690-------700 .................................................................................................... -------710-------720-------730-------740-------750-------760-------770-------780-------790-------800 .................................................................................................... -------810-------820-------830-------840-------850-------860-------870-------880-------890-------900 .................................................................................................... -------910-------920-------930-------940-------950-------960-------970-------980-------990------1000 MTTRLTRWLTALDNFEAKMALL ------1010------1020--
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQVLFQG ||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||| ..STVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPG..RSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIG...... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-----------1010------1020----- PSAGLVPRGSGGIEGMTTRLTRWLTALDNFEAKMALLPAV |||| ...........GIEG..................................................................................... -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 .................................................................................................... -------210-------220-------230-------240-------250-------260-------270-------280-------290-------300 .................................................................................................... -------310-------320-------330-------340-------350-------360-------370-------380-------390-------400 .................................................................................................... -------410-------420-------430-------440-------450-------460-------470-------480-------490-------500 .................................................................................................... -------510-------520-------530-------540-------550-------560-------570-------580-------590-------600 .................................................................................................... -------610-------620-------630-------640-------650-------660-------670-------680-------690-------700 .................................................................................................... -------710-------720-------730-------740-------750-------760-------770-------780-------790-------800 .................................................................................................... -------810-------820-------830-------840-------850-------860-------870-------880-------890-------900 .................................................................................................... -------910-------920-------930-------940-------950-------960-------970-------980-------990------1000 MTTRLTRWLTALDNFEAKMALL ------1010------1020--