Solution structure of response regulator protein from Burkholderia multivorans
MIRTILAIDD SATMRALLHA TLAQAGYEVT VAADGEAGFD LAATTAYDLV LTDQNMPRKS GLELIAALRQ LSAYADTPIL VLTTEGSDAF KAAARDAGAT GWIEKPIDPG VLVELVATLS EPAAN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.1 % (1160 of 1332) | 85.7 % (574 of 670) | 88.2 % (473 of 536) | 89.7 % (113 of 126) |
Backbone | 92.3 % (683 of 740) | 93.7 % (237 of 253) | 91.6 % (336 of 367) | 91.7 % (110 of 120) |
Sidechain | 82.8 % (587 of 709) | 80.8 % (337 of 417) | 86.4 % (247 of 286) | 50.0 % (3 of 6) |
Aromatic | 65.0 % (39 of 60) | 76.7 % (23 of 30) | 51.7 % (15 of 29) | 100.0 % (1 of 1) |
Methyl | 95.9 % (186 of 194) | 96.9 % (94 of 97) | 94.8 % (92 of 97) |
1. entity 1
MIRTILAIDD SATMRALLHA TLAQAGYEVT VAADGEAGFD LAATTAYDLV LTDQNMPRKS GLELIAALRQ LSAYADTPIL VLTTEGSDAF KAAARDAGAT GWIEKPIDPG VLVELVATLS EPAANSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | HEPES | natural abundance | 25 mM | |
4 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | HEPES | natural abundance | 25 mM | |
4 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | HEPES | natural abundance | 25 mM | |
4 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.9 mM [U-13C; U-15N] response regulator protein, 25 mM HEPES, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | natural abundance | 25 mM | |
2 | response regulator protein | [U-13C; U-15N] | 0.9 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30161_5t3y.nef |
Input source #2: Coordindates | 5t3y.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQNMPRKSGLELIAALRQLSAYADTPILVLTTEGSDAFKAAARDAGAT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQNMPRKSGLELIAALRQLSAYADTPILVLTTEGSDAFKAAARDAGAT -------110-------120----- GWIEKPIDPGVLVELVATLSEPAAN ||||||||||||||||||||||||| GWIEKPIDPGVLVELVATLSEPAAN
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 125 | 0 | 0 | 100.0 |
Content subtype: combined_30161_5t3y.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQNMPRKSGLELIAALRQLSAYADTPILVLTTEGSDAFKAAARDAGAT ||||||||||||||||||||||||||||||||||||||||||||||||||||| | | || |||||||||||||||||||||||||||||||||||| MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTD...P.K.GL..IAALRQLSAYADTPILVLTTEGSDAFKAAARDAGAT -------110-------120----- GWIEKPIDPGVLVELVATLSEPAAN ||||||||||||||||||||||||| GWIEKPIDPGVLVELVATLSEPAAN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 670 | 552 | 82.4 |
13C chemical shifts | 536 | 468 | 87.3 |
15N chemical shifts | 131 | 111 | 84.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 253 | 233 | 92.1 |
13C chemical shifts | 250 | 224 | 89.6 |
15N chemical shifts | 120 | 109 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 417 | 319 | 76.5 |
13C chemical shifts | 286 | 244 | 85.3 |
15N chemical shifts | 11 | 2 | 18.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 100 | 92 | 92.0 |
13C chemical shifts | 100 | 92 | 92.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 23 | 76.7 |
13C chemical shifts | 29 | 15 | 51.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQNMPRKSGLELIAALRQLSAYADTPILVLTTEGSDAFKAAARDAGAT ||||||||||||||||||||||||||||||||||||||||||||||||||||| | | |||||||||||||||||||||||||||||||||||| MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTD.....K..L..IAALRQLSAYADTPILVLTTEGSDAFKAAARDAGAT -------110-------120----- GWIEKPIDPGVLVELVATLSEPAAN ||||||||||||||||||||||||| GWIEKPIDPGVLVELVATLSEPAAN
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQNMPRKSGLELIAALRQLSAYADTPILVLTTEGSDAFKAAARDAGAT ||||||||||||||||||||||||||||||| ||||||||||| |||||| |||||||| ||||||| |||||||||||| ..RTILAIDDSATMRALLHATLAQAGYEVTVAA.GEAGFDLAATT..DLVLTD..........LIAALRQL......PILVLTT..SDAFKAAARDAG.. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120----- GWIEKPIDPGVLVELVATLSEPAAN |||||| |||||||||||| GWIEKP..PGVLVELVATLS -------110-------120