Solution structure of the CaM34 with the iNOS CaM binding domain peptide
ADQLTEEQIA EFKEAFSLFD KDGDGTITTK ELGTVMRSLG QNPTEAELQD MINEVDADGN GTIDFPEFLT MMARKMKDTD SEEEIREAFR VFAKDGNGYI SAAELRHVMT NLGEKLTDEE VDEMIREAAI DGDGQVNYEE FVQMMTAK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.9 % (1506 of 2038) | 81.0 % (861 of 1063) | 60.5 % (478 of 790) | 90.3 % (167 of 185) |
Backbone | 78.1 % (823 of 1054) | 91.7 % (332 of 362) | 63.4 % (329 of 519) | 93.6 % (162 of 173) |
Sidechain | 71.4 % (820 of 1149) | 75.5 % (529 of 701) | 65.6 % (286 of 436) | 41.7 % (5 of 12) |
Aromatic | 13.2 % (15 of 114) | 14.0 % (8 of 57) | 12.3 % (7 of 57) | |
Methyl | 82.1 % (151 of 184) | 91.3 % (84 of 92) | 72.8 % (67 of 92) |
1. Calmodulin
ADQLTEEQIA EFKEAFSLFD KDGDGTITTK ELGTVMRSLG QNPTEAELQD MINEVDADGN GTIDFPEFLT MMARKMKDTD SEEEIREAFR VFAKDGNGYI SAAELRHVMT NLGEKLTDEE VDEMIREAAI DGDGQVNYEE FVQMMTAK2. Nitric oxide synthase, inducible
AGHMRPKRRE IPLKVLVKAV LFACMLMRKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1 mM [U-99% 13C; U-99% 15N] CaM34, 1 mM iNOS CaM binding domain peptide, 100 mM potassium chloride, 10 mM Calcium chloride, 0.2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaM34 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Calcium chloride | natural abundance | 10 mM | |
3 | iNOS CaM binding domain peptide | natural abundance | 1 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 0.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1 mM [U-99% 13C; U-99% 15N] CaM34, 1 mM iNOS CaM binding domain peptide, 100 mM potassium chloride, 10 mM Calcium chloride, 0.2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaM34 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Calcium chloride | natural abundance | 10 mM | |
3 | iNOS CaM binding domain peptide | natural abundance | 1 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 0.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1 mM [U-99% 13C; U-99% 15N] CaM34, 1 mM iNOS CaM binding domain peptide, 100 mM potassium chloride, 10 mM Calcium chloride, 0.2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaM34 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Calcium chloride | natural abundance | 10 mM | |
3 | iNOS CaM binding domain peptide | natural abundance | 1 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 0.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1 mM [U-99% 13C; U-99% 15N] CaM34, 1 mM iNOS CaM binding domain peptide, 100 mM potassium chloride, 10 mM Calcium chloride, 0.2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaM34 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Calcium chloride | natural abundance | 10 mM | |
3 | iNOS CaM binding domain peptide | natural abundance | 1 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 0.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1 mM [U-99% 13C; U-99% 15N] CaM34, 1 mM iNOS CaM binding domain peptide, 100 mM potassium chloride, 10 mM Calcium chloride, 0.2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaM34 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Calcium chloride | natural abundance | 10 mM | |
3 | iNOS CaM binding domain peptide | natural abundance | 1 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 0.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1 mM [U-99% 13C; U-99% 15N] CaM34, 1 mM iNOS CaM binding domain peptide, 100 mM potassium chloride, 10 mM Calcium chloride, 0.2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaM34 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Calcium chloride | natural abundance | 10 mM | |
3 | iNOS CaM binding domain peptide | natural abundance | 1 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 0.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1 mM [U-99% 13C; U-99% 15N] CaM34, 1 mM iNOS CaM binding domain peptide, 100 mM potassium chloride, 10 mM Calcium chloride, 0.2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaM34 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Calcium chloride | natural abundance | 10 mM | |
3 | iNOS CaM binding domain peptide | natural abundance | 1 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 0.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30196_5tp6.nef |
Input source #2: Coordindates | 5tp6.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFAKDGNGYI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFAKDGNGYI -------110-------120-------130-------140-------- SAAELRHVMTNLGEKLTDEEVDEMIREAAIDGDGQVNYEEFVQMMTAK |||||||||||||||||||||||||||||||||||||||||||||||| SAAELRHVMTNLGEKLTDEEVDEMIREAAIDGDGQVNYEEFVQMMTAK
-----510-------520-------530- AGHMRPKRREIPLKVLVKAVLFACMLMRK ||||||||||||||||||||||||||||| AGHMRPKRREIPLKVLVKAVLFACMLMRK --------10--------20---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 148 | 0 | 0 | 100.0 |
B | B | 29 | 0 | 0 | 100.0 |
Content subtype: combined_30196_5tp6.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFAKDGNGYI ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||| ||||||||||||||||||||||||||||||||| .DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQN.TEAELQDMINEVDADGNGTIDF.EFLTMMARKMKDTDSEEEIREAFRVFAKDGNGY. -------110-------120-------130-------140-------- SAAELRHVMTNLGEKLTDEEVDEMIREAAIDGDGQVNYEEFVQMMTAK |||||||||||||||||||||||||||||||||||||||||||||||| SAAELRHVMTNLGEKLTDEEVDEMIREAAIDGDGQVNYEEFVQMMTAK
-----510-------520-------530- AGHMRPKRREIPLKVLVKAVLFACMLMRK ||||||||||||||||| ............LKVLVKAVLFACMLMRK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
50 | ASP | CG | 33.593 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 865 | 741 | 85.7 |
13C chemical shifts | 645 | 420 | 65.1 |
15N chemical shifts | 164 | 144 | 87.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 305 | 298 | 97.7 |
13C chemical shifts | 296 | 147 | 49.7 |
15N chemical shifts | 146 | 144 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 560 | 443 | 79.1 |
13C chemical shifts | 349 | 273 | 78.2 |
15N chemical shifts | 18 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 71 | 86.6 |
13C chemical shifts | 82 | 66 | 80.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 0 | 0.0 |
13C chemical shifts | 50 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 198 | 98 | 49.5 |
13C chemical shifts | 145 | 17 | 11.7 |
15N chemical shifts | 31 | 17 | 54.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 34 | 59.6 |
13C chemical shifts | 58 | 17 | 29.3 |
15N chemical shifts | 27 | 17 | 63.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 141 | 64 | 45.4 |
13C chemical shifts | 87 | 0 | 0.0 |
15N chemical shifts | 4 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 15 | 68.2 |
13C chemical shifts | 22 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 7 | 2 | 28.6 |
13C chemical shifts | 7 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFAKDGNGYI ||||||||||||||||||||||||||||||||||||||| |||||| ||||||||||||||| ||||||||||||||||||||||||||||||||| ...LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQN.TEAELQ.MINEVDADGNGTIDF.EFLTMMARKMKDTDSEEEIREAFRVFAKDGNGY. -------110-------120-------130-------140-------- SAAELRHVMTNLGEKLTDEEVDEMIREAAIDGDGQVNYEEFVQMMTAK |||||||||||||||||||||||||||||||||||||||||||||||| SAAELRHVMTNLGEKLTDEEVDEMIREAAIDGDGQVNYEEFVQMMTAK
-----510-------520-------530- AGHMRPKRREIPLKVLVKAVLFACMLMRK ||||||||||||||||| ............LKVLVKAVLFACMLMRK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFAKDGNGYI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| ..QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFA...NGYI -------110-------120-------130-------140-------- SAAELRHVMTNLGEKLTDEEVDEMIREAAIDGDGQVNYEEFVQMMTAK ||||||||||||||||||||||||||||||| |||||||||||||||| SAAELRHVMTNLGEKLTDEEVDEMIREAAID.DGQVNYEEFVQMMTAK