BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	86.9 % (545 of 627)	83.3 % (265 of 318)	88.3 % (219 of 248)	100.0 % (61 of 61)
Backbone	97.3 % (327 of 336)	95.7 % (111 of 116)	97.6 % (160 of 164)	100.0 % (56 of 56)
Sidechain	78.4 % (269 of 343)	76.2 % (154 of 202)	80.9 % (110 of 136)	100.0 % (5 of 5)
Aromatic	35.4 % (17 of 48)	66.7 % (16 of 24)	0.0 % (0 of 23)	100.0 % (1 of 1)
Methyl	97.1 % (68 of 70)	97.1 % (34 of 35)	97.1 % (34 of 35)

1. entity 1

MTFKLIINGK TLKGETTTEA VDAATAEKVL KQYANDNGID GEWTYDDATK TFTVTE

Show sample condition

Sample #1

Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-98% 15N] protein (GB1), 10 mM sodium phosphate, 90% H2O, 10% D2O

#	Name	Isotope labeling	Type	Concentration
1	protein (GB1)	[U-98% 15N]		1.0 mM
2	sodium phosphate	natural abundance		10 mM

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 90% H2O/10% D2O

#	Name	Isotope labeling	Type	Concentration
3	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
4	sodium phosphate	natural abundance		10 mM

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 100% D2O

#	Name	Isotope labeling	Type	Concentration
5	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
6	sodium phosphate	natural abundance		10 mM

Chem. Shift Complete2

Sequence coverage: 100.0 %, Completeness: 76.6 %, Completeness (bb): 77.4 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	76.6 % (960 of 1254)	77.8 % (495 of 636)	79.2 % (393 of 496)	59.0 % (72 of 122)
Backbone	77.4 % (520 of 672)	77.6 % (180 of 232)	83.8 % (275 of 328)	58.0 % (65 of 112)
Sidechain	79.0 % (542 of 686)	78.0 % (315 of 404)	80.9 % (220 of 272)	70.0 % (7 of 10)
Aromatic	35.4 % (34 of 96)	66.7 % (32 of 48)	0.0 % (0 of 46)	100.0 % (2 of 2)
Methyl	97.1 % (136 of 140)	97.1 % (68 of 70)	97.1 % (68 of 70)

1. entity 1

MTFKLIINGK TLKGETTTEA VDAATAEKVL KQYANDNGID GEWTYDDATK TFTVTE

Show sample condition

Sample #1

Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-98% 15N] protein (GB1), 10 mM sodium phosphate, 90% H2O, 10% D2O

#	Name	Isotope labeling	Type	Concentration
1	protein (GB1)	[U-98% 15N]		1.0 mM
2	sodium phosphate	natural abundance		10 mM

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 90% H2O/10% D2O

#	Name	Isotope labeling	Type	Concentration
3	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
4	sodium phosphate	natural abundance		10 mM

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 100% D2O

#	Name	Isotope labeling	Type	Concentration
5	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
6	sodium phosphate	natural abundance		10 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.31 ppm, Outliers: 2 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.31 ppm, Outliers: 2 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.16 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 10 models in PDB: 5UB0, Strand ID: A Detail

Release date

2017-02-01

Citation

Rational design of proteins that exchange on functional timescales
Davey, J.A., Damry, A.M., Goto, N.K., Chica, R.A.
Nat. Chem. Biol. (2017), 13, 1280-1285, PubMed 29058725 , DOI 10.1038/nchembio.2503 , Abstract

Related entities 1. Immunoglobulin G-binding protein G, : 1 : 3 : 102 entities Detail

Sample

#	Name	Isotope labeling	Type	Concentration
3	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
4	sodium phosphate	natural abundance		10 mM

6 3D CCH-TOCSY

Instrument

Varian Inova - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 100% D2O

#	Name	Isotope labeling	Type	Concentration
5	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
6	sodium phosphate	natural abundance		10 mM

7 3D HNCO

Instrument

Varian Inova - 500 MHz

Sample

#	Name	Isotope labeling	Type	Concentration
3	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
4	sodium phosphate	natural abundance		10 mM

8 3D HCCH-COSY

Instrument

Varian Inova - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 100% D2O

#	Name	Isotope labeling	Type	Concentration
5	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
6	sodium phosphate	natural abundance		10 mM

9 3D HCCH-TOCSY

Instrument

Varian Inova - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 100% D2O

#	Name	Isotope labeling	Type	Concentration
5	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
6	sodium phosphate	natural abundance		10 mM

10 2D 1H-13C HSQC

Instrument

Varian Inova - 500 MHz

Sample

#	Name	Isotope labeling	Type	Concentration
3	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
4	sodium phosphate	natural abundance		10 mM

11 2D 1H-13C HSQC

Instrument

Varian Inova - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 100% D2O

#	Name	Isotope labeling	Type	Concentration
5	protein (GB1)	[U-99% 13C; U-98% 15N]		1.0 mM
6	sodium phosphate	natural abundance		10 mM

12 2D 1H-15N HSQC

Instrument

Varian Inova - 500 MHz

Sample

State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.0 mM [U-98% 15N] protein (GB1), 10 mM sodium phosphate, 90% H2O, 10% D2O

#	Name	Isotope labeling	Type	Concentration
1	protein (GB1)	[U-98% 15N]		1.0 mM
2	sodium phosphate	natural abundance		10 mM

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_30220_5ub0.nef
Input source #2: Coordindates	5ub0.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50------
MTFKLIINGKTLKGETTTEAVDAATAEKVLKQYANDNGIDGEWTYDDATKTFTVTE
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MTFKLIINGKTLKGETTTEAVDAATAEKVLKQYANDNGIDGEWTYDDATKTFTVTE

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	56	0	0	100.0

Content subtype: combined_30220_5ub0.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chemical_shifts_1	Warning	564		100.0 (chain: A, length: 56)
2	Assigned chemical shifts	assigned_chemical_shifts_2	Warning	383		100.0 (chain: A, length: 56)
1	Distance restraints	DYANA/DIANA_distance_constraints_3	Warning	953 (1)	noe	100.0 (chain: A, length: 56)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_2	OK	90 (90)	.	98.2 (chain: A, length: 56)

Assigned chemical shifts

Saveframe: assigned_chemical_shifts_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 282
  - ¹³C chemical shifts: 221
  - ¹⁵N chemical shifts: 61
- Completeness of assignments
  - Entity_assemble_ID: A
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
Saveframe: assigned_chemical_shifts_2
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 217
  - ¹³C chemical shifts: 166
- Completeness of assignments
  - Entity_assemble_ID: A
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	318	281	88.4
¹³C chemical shifts	248	221	89.1
¹⁵N chemical shifts	61	61	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	116	114	98.3
¹³C chemical shifts	112	111	99.1
¹⁵N chemical shifts	56	56	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	202	167	82.7
¹³C chemical shifts	136	110	80.9
¹⁵N chemical shifts	5	5	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	36	34	94.4
¹³C chemical shifts	36	34	94.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	24	16	66.7
¹³C chemical shifts	23	0	0.0
¹⁵N chemical shifts	1	1	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	318	217	68.2
¹³C chemical shifts	248	166	66.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	116	59	50.9
¹³C chemical shifts	112	56	50.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	202	158	78.2
¹³C chemical shifts	136	110	80.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	36	34	94.4
¹³C chemical shifts	36	34	94.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	24	15	62.5
¹³C chemical shifts	23	0	0.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_3
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 100.0%
- Total number of restraints: 953
- Weight of restraints: 1.0 (953)
- Potential type of restraints: upper-bound-parabolic (953)
- Range of distance target values: 2.56, 5.5 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_2
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 98.2%
- Total number of restraints: 90
- Total number of restraints per polymer type: 90
- Weight of restraints: 1.0 (90)
- Potential type of restraints: square-well-parabolic (90)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords DE NOVO PROTEIN, computational design, conformational exchange, dynamics, immunoglobulin-binding

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.575 seconds)

BMRB: 30220

Sample #1

Sample #2

Sample #3

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. Immunoglobulin G-binding protein G, : 1 : 3 : 102 entities Detail

Interaction partners 1. Immunoglobulin G-binding protein G, : 1 interactors Detail

Experiments performed 12 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 5 contents Detail