Solution-state NMR structural ensemble of human Tsg101 UEV in complex with tenatoprazole
GAVSESQLKK MVSKYKYRDL TVRETVNVIT LYKDLKPVLD SYVFNDGSSR ELMNLTGTIP VPYRGNTYNI PICLWLLDTY PYNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKHP QSDLLGLIQV MIVVFGDEPP VFSRP
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS73:SG | 2:4N11:S20 |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.7 % (1573 of 1754) | 97.3 % (887 of 912) | 77.8 % (543 of 698) | 99.3 % (143 of 144) |
Backbone | 83.9 % (708 of 844) | 97.9 % (279 of 285) | 69.8 % (298 of 427) | 99.2 % (131 of 132) |
Sidechain | 95.6 % (1001 of 1047) | 97.0 % (608 of 627) | 93.4 % (381 of 408) | 100.0 % (12 of 12) |
Aromatic | 88.5 % (138 of 156) | 96.2 % (75 of 78) | 80.3 % (61 of 76) | 100.0 % (2 of 2) |
Methyl | 97.7 % (172 of 176) | 100.0 % (88 of 88) | 95.5 % (84 of 88) |
1. entity 1
GAVSESQLKK MVSKYKYRDL TVRETVNVIT LYKDLKPVLD SYVFNDGSSR ELMNLTGTIP VPYRGNTYNI PICLWLLDTY PYNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKHP QSDLLGLIQV MIVVFGDEPP VFSRPSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tenatoprazole | natural abundance | 0.6 mM | |
2 | Tsg101 | [U-98% 13C; U-98% 15N] | 0.6 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Tenatoprazole | natural abundance | 0.6 mM | |
6 | Tsg101 | [U-13C; U-15N] | 0.6 mM | |
7 | potassium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz Cryoprobe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tenatoprazole | natural abundance | 0.6 mM | |
2 | Tsg101 | [U-98% 13C; U-98% 15N] | 0.6 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz Cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Tenatoprazole | natural abundance | 0.6 mM | |
6 | Tsg101 | [U-13C; U-15N] | 0.6 mM | |
7 | potassium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz Cryoprobe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tenatoprazole | natural abundance | 0.6 mM | |
2 | Tsg101 | [U-98% 13C; U-98% 15N] | 0.6 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz Cryoprobe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tenatoprazole | natural abundance | 0.6 mM | |
2 | Tsg101 | [U-98% 13C; U-98% 15N] | 0.6 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz Cryoprobe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tenatoprazole | natural abundance | 0.6 mM | |
2 | Tsg101 | [U-98% 13C; U-98% 15N] | 0.6 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Tenatoprazole | natural abundance | 0.6 mM | |
6 | Tsg101 | [U-13C; U-15N] | 0.6 mM | |
7 | potassium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz Cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Tenatoprazole | natural abundance | 0.6 mM | |
6 | Tsg101 | [U-13C; U-15N] | 0.6 mM | |
7 | potassium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz Cryoprobe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tenatoprazole | natural abundance | 0.6 mM | |
2 | Tsg101 | [U-98% 13C; U-98% 15N] | 0.6 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz Cryoprobe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tenatoprazole | natural abundance | 0.6 mM | |
2 | Tsg101 | [U-98% 13C; U-98% 15N] | 0.6 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz Cryoprobe
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Tenatoprazole | natural abundance | 0.6 mM | |
2 | Tsg101 | [U-98% 13C; U-98% 15N] | 0.6 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30285_5vkg.nef |
Input source #2: Coordindates | 5vkg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:73:CYS:SG | 2:1:4N1:S20 | unknown | unknown | n/a |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | 4N1 | 4-methoxy-1-(5-methoxy-3H-imidazo[4,5-b]pyridin-2-yl)-3,5-dimethyl-2-(sulfanylmethyl)pyridin-1-ium | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG -------110-------120-------130-------140----- KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP ||||||||||||||||||||||||||||||||||||||||||||| KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 145 | 0 | 0 | 100.0 |
Content subtype: combined_30285_5vkg.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG -------110-------120-------130-------140----- KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP ||||||||||||||||||||||||||||||||||||||||||||| KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
15 | TYR | HH | 9.445 |
21 | THR | HG1 | 3.851 |
25 | THR | HG1 | 3.915 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 912 | 891 | 97.7 |
13C chemical shifts | 698 | 521 | 74.6 |
15N chemical shifts | 149 | 143 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 285 | 281 | 98.6 |
13C chemical shifts | 290 | 143 | 49.3 |
15N chemical shifts | 132 | 131 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 627 | 610 | 97.3 |
13C chemical shifts | 408 | 378 | 92.6 |
15N chemical shifts | 17 | 12 | 70.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 92 | 92 | 100.0 |
13C chemical shifts | 92 | 87 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 75 | 96.2 |
13C chemical shifts | 76 | 61 | 80.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG -------110-------120-------130-------140----- KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP ||||||||||||||||||||||||||||||||||||||||||||| KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG | ||||||||||| |||||||||||||| | ||||| || | || |||||| ||||||| ||||||||||| | ||||||||||||||||||| ..V.ESQLKKMVSKY.YRDLTVRETVNVIT.Y..LKPVL.SY.F..GS.RELMNL.GTIPVPY..NTYNIPICLWL...Y.YNPPICFVKPTSSMTIKTG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140----- KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP || ||||||||||| ||||||||||||||||||||||| || | .HV.ANGKIYLPYLH.WKHPQSDLLGLIQVMIVVFGDEP.VF.R -------110-------120-------130-------140----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG -------110-------120-------130-------140----- KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP ||||||||||||||||||||||||||||||||||||||||||||| KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP