Solution NMR structure of the HMG domain of human FACT complex subunit SSRP1
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.6 % (732 of 826) | 90.0 % (396 of 440) | 85.4 % (268 of 314) | 94.4 % (68 of 72) |
Backbone | 93.7 % (386 of 412) | 92.3 % (132 of 143) | 94.5 % (190 of 201) | 94.1 % (64 of 68) |
Sidechain | 85.1 % (406 of 477) | 88.9 % (264 of 297) | 78.4 % (138 of 176) | 100.0 % (4 of 4) |
Aromatic | 45.6 % (31 of 68) | 82.4 % (28 of 34) | 0.0 % (0 of 31) | 100.0 % (3 of 3) |
Methyl | 100.0 % (42 of 42) | 100.0 % (21 of 21) | 100.0 % (21 of 21) |
1. entity 1
GHMSAYMLWL NASREKIKSD HPGISITDLS KKAGEIWKGM SKEKKEEWDR KAEDARRDYE KAMKEYEGGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9, Details 0.6 mM [U-100% 13C; U-100% 15N] Human SSRP1 HMG Domain, 50 mM Sodium phosphate buffer, 50 mM NaCl, 90% H2O/10% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Human SSRP1 HMG Domain | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | NaCl | natural abundance | 50 mM | |
3 | Sodium phosphate buffer | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30296_5vwe.nef |
Input source #2: Coordindates | 5vwe.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-550-----560-------570-------580-------590-------600-------610------- GHMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGG --------10--------20--------30--------40--------50--------60---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 69 | 0 | 0 | 100.0 |
Content subtype: combined_30296_5vwe.nef
Assigned chemical shifts
-550-----560-------570-------580-------590-------600-------610------- GHMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...SAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 314 | 269 | 85.7 |
1H chemical shifts | 440 | 405 | 92.0 |
15N chemical shifts | 76 | 68 | 89.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 138 | 131 | 94.9 |
1H chemical shifts | 143 | 134 | 93.7 |
15N chemical shifts | 68 | 64 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 176 | 138 | 78.4 |
1H chemical shifts | 297 | 271 | 91.2 |
15N chemical shifts | 8 | 4 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 25 | 24 | 96.0 |
1H chemical shifts | 25 | 24 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 31 | 0 | 0.0 |
1H chemical shifts | 34 | 28 | 82.4 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
-550-----560-------570-------580-------590-------600-------610------- GHMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...SAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGG
Dihedral angle restraints
-550-----560-------570-------580-------590-------600-------610------- GHMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...SAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKE -550-----560-------570-------580-------590-------600-------610---