NMR solution structure of the CARD9 CARD bound to zinc
MSDYENDDEC WSVLEGFRVT LTSVIDPSRI TPYLRQCKVL NPDDEEQVLS DPNLVIRKRK VGVLLDILQR TGHKGYVAFL ESLELYYPQL YKKVTGK
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | metal coordination | sing | 1:ASP7:OD2 | 2:ZN1:ZN |
2 | metal coordination | sing | 1:CYS10:SG | 2:ZN1:ZN |
3 | metal coordination | sing | 1:HIS73:ND1 | 2:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.2 % (1055 of 1170) | 95.6 % (584 of 611) | 81.7 % (375 of 459) | 96.0 % (96 of 100) |
Backbone | 84.1 % (481 of 572) | 95.9 % (186 of 194) | 72.4 % (207 of 286) | 95.7 % (88 of 92) |
Sidechain | 96.4 % (665 of 690) | 95.4 % (398 of 417) | 97.7 % (259 of 265) | 100.0 % (8 of 8) |
Aromatic | 92.9 % (78 of 84) | 92.9 % (39 of 42) | 92.7 % (38 of 41) | 100.0 % (1 of 1) |
Methyl | 99.2 % (119 of 120) | 98.3 % (59 of 60) | 100.0 % (60 of 60) |
1. entity 1
MSDYENDDEC WSVLEGFRVT LTSVIDPSRI TPYLRQCKVL NPDDEEQVLS DPNLVIRKRK VGVLLDILQR TGHKGYVAFL ESLELYYPQL YKKVTGKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Solvent system 50% H2O/50% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-10% 13C; U-100% 15N] CARD9 CARD, 0.46 mM zinc, 50% H2O/50% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | CARD9 CARD | [U-10% 13C; U-100% 15N] | 0.40 mM | |
4 | zinc | none | 0.46 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
6 | zinc | none | 0.46 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 50% H2O/50% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-10% 13C; U-100% 15N] CARD9 CARD, 0.46 mM zinc, 50% H2O/50% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | CARD9 CARD | [U-10% 13C; U-100% 15N] | 0.40 mM | |
4 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
6 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
6 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM | |
2 | zinc | none | 0.46 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30491_6e25.nef |
Input source #2: Coordindates | 6e25.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:7:ASP:OD2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:10:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:73:HIS:ND1 | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 97 | 0 | 0 | 100.0 |
Content subtype: combined_30491_6e25.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
71 | THR | HG1 | 5.172 |
82 | SER | HG | 4.835 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 611 | 589 | 96.4 |
13C chemical shifts | 459 | 355 | 77.3 |
15N chemical shifts | 106 | 95 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 194 | 188 | 96.9 |
13C chemical shifts | 194 | 96 | 49.5 |
15N chemical shifts | 92 | 87 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 417 | 401 | 96.2 |
13C chemical shifts | 265 | 259 | 97.7 |
15N chemical shifts | 14 | 8 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 60 | 98.4 |
13C chemical shifts | 61 | 60 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 39 | 92.9 |
13C chemical shifts | 41 | 38 | 92.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..DYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK ||||||||||||||||||| |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......DDECWSVLEGFRVTLTSVI.PSRI.PYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTG --------10--------20--------30--------40--------50--------60--------70--------80--------90------