NMR solution structure of Bcd1p120-303 from Saccharomyces cerevisiae
GPHMRDSTEC QRIIRRGVNC LMLPKGMQRS SQNRSKWDKT MDLFVWSVEW ILCPMQEKGE KKELFKHVSH RIKETDFLVQ GMGKNVFQKC CEFYRLAGTS SCIEGEDGSE TKEERTQILQ KSGLKFYTKT FPYNTTHIMD SKKLVELAIH EKCIGELLKN TTVIEFPTIF VAMTEADLPE GYEVLHQE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.1 % (2197 of 2285) | 97.6 % (1167 of 1196) | 94.0 % (828 of 881) | 97.1 % (202 of 208) |
Backbone | 99.6 % (1112 of 1116) | 99.7 % (381 of 382) | 99.6 % (550 of 552) | 99.5 % (181 of 182) |
Sidechain | 93.8 % (1261 of 1345) | 96.6 % (786 of 814) | 89.9 % (454 of 505) | 80.8 % (21 of 26) |
Aromatic | 69.2 % (126 of 182) | 86.8 % (79 of 91) | 50.0 % (44 of 88) | 100.0 % (3 of 3) |
Methyl | 100.0 % (180 of 180) | 100.0 % (90 of 90) | 100.0 % (90 of 90) |
1. entity 1
GPHMRDSTEC QRIIRRGVNC LMLPKGMQRS SQNRSKWDKT MDLFVWSVEW ILCPMQEKGE KKELFKHVSH RIKETDFLVQ GMGKNVFQKC CEFYRLAGTS SCIEGEDGSE TKEERTQILQ KSGLKFYTKT FPYNTTHIMD SKKLVELAIH EKCIGELLKN TTVIEFPTIF VAMTEADLPE GYEVLHQESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N; U-2H] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Box C/D snoRNA protein 1 | [U-13C; U-15N; U-2H] | 1 mM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | TCEP | natural abundance | 0.5 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 12 mg/mL Pf1 phage, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Box C/D snoRNA protein 1 | [U-15N] | 1 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | sodium phosphate | natural abundance | 10 mM | |
12 | TCEP | natural abundance | 0.5 mM | |
13 | Pf1 phage | natural abundance | 12 mg/mL |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N; U-2H] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Box C/D snoRNA protein 1 | [U-13C; U-15N; U-2H] | 1 mM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N; U-2H] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Box C/D snoRNA protein 1 | [U-13C; U-15N; U-2H] | 1 mM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N; U-2H] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Box C/D snoRNA protein 1 | [U-13C; U-15N; U-2H] | 1 mM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Box C/D snoRNA protein 1 | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N; U-2H] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Box C/D snoRNA protein 1 | [U-13C; U-15N; U-2H] | 1 mM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N; U-2H] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Box C/D snoRNA protein 1 | [U-13C; U-15N; U-2H] | 1 mM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N; U-2H] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Box C/D snoRNA protein 1 | [U-13C; U-15N; U-2H] | 1 mM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N; U-2H] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Box C/D snoRNA protein 1 | [U-13C; U-15N; U-2H] | 1 mM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-13C; U-15N; U-2H] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Box C/D snoRNA protein 1 | [U-13C; U-15N; U-2H] | 1 mM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | TCEP | natural abundance | 0.5 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4, Details 1 mM [U-15N] Box C/D snoRNA protein 1, 150 mM sodium chloride, 10 mM sodium phosphate, 0.5 mM TCEP, 12 mg/mL Pf1 phage, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Box C/D snoRNA protein 1 | [U-15N] | 1 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | sodium phosphate | natural abundance | 10 mM | |
12 | TCEP | natural abundance | 0.5 mM | |
13 | Pf1 phage | natural abundance | 12 mg/mL |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30570_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPHMRDSTECQRIIRRGVNCLMLPKGMQRSSQNRSKWDKTMDLFVWSVEWILCPMQEKGEKKELFKHVSHRIKETDFLVQGMGKNVFQKCCEFYRLAGTS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PHMRDSTECQRIIRRGVNCLMLPKGMQRSSQNRSKWDKTMDLFVWSVEWILCPMQEKGEKKELFKHVSHRIKETDFLVQGMGKNVFQKCCEFYRLAGTS -------110-------120-------130-------140-------150-------160-------170-------180-------- SCIEGEDGSETKEERTQILQKSGLKFYTKTFPYNTTHIMDSKKLVELAIHEKCIGELLKNTTVIEFPTIFVAMTEADLPEGYEVLHQE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SCIEGEDGSETKEERTQILQKSGLKFYTKTFPYNTTHIMDSKKLVELAIHEKCIGELLKNTTVIEFPTIFVAMTEADLPEGYEVLHQE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
94 | TYR | HH | 7.701 |
122 | SER | HG | 5.652 |
161 | THR | HG1 | 5.792 |
168 | THR | HG1 | 5.747 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1196 | 1159 | 96.9 |
13C chemical shifts | 881 | 824 | 93.5 |
15N chemical shifts | 208 | 202 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 382 | 378 | 99.0 |
13C chemical shifts | 376 | 373 | 99.2 |
15N chemical shifts | 182 | 181 | 99.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 814 | 781 | 95.9 |
13C chemical shifts | 505 | 451 | 89.3 |
15N chemical shifts | 26 | 21 | 80.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 98 | 96 | 98.0 |
13C chemical shifts | 98 | 96 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 91 | 77 | 84.6 |
13C chemical shifts | 88 | 42 | 47.7 |
15N chemical shifts | 3 | 3 | 100.0 |