Structural Basis for Client Recognition and Activity of Hsp40 Chaperones
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.5 % (847 of 957) | 85.9 % (427 of 497) | 90.4 % (340 of 376) | 95.2 % (80 of 84) |
Backbone | 92.2 % (483 of 524) | 92.6 % (176 of 190) | 90.1 % (227 of 252) | 97.6 % (80 of 82) |
Sidechain | 85.5 % (432 of 505) | 81.8 % (251 of 307) | 92.3 % (181 of 196) | 0.0 % (0 of 2) |
Aromatic | 44.4 % (8 of 18) | 44.4 % (4 of 9) | 44.4 % (4 of 9) | |
Methyl | 96.6 % (114 of 118) | 93.2 % (55 of 59) | 100.0 % (59 of 59) |
1. entity 1
MSTIALALLP LGSGGSGGSG GSGRDLRAEL PLTLEEAFHG GERVVEVAGR RVSVRIPPGV REGSVIRVPG MGGQGNPPGD LLLVVRLLPHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-13C; U-15N] PhoA-CBD1, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PhoA-CBD1 | [U-13C; U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 75 mM | |
4 | sodium azide | natural abundance | 0.04 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30627_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90 MSTIALALLPLGSGGSGGSGGSGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRIPPGVREGSVIRVPGMGGQGNPPGDLLLVVRLLPH |||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||| ||||||||||||| MSTIALALLPLGSGGSGGSGGSGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRI.PGVREGSVIRVPGMGGQGN.PGDLLLVVRLLPH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 497 | 425 | 85.5 |
13C chemical shifts | 376 | 338 | 89.9 |
15N chemical shifts | 93 | 80 | 86.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 190 | 176 | 92.6 |
13C chemical shifts | 180 | 157 | 87.2 |
15N chemical shifts | 82 | 80 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 307 | 249 | 81.1 |
13C chemical shifts | 196 | 181 | 92.3 |
15N chemical shifts | 11 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 56 | 91.8 |
13C chemical shifts | 61 | 60 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 9 | 4 | 44.4 |
13C chemical shifts | 9 | 4 | 44.4 |