Structural characterization of the type III secretion system pilotin-secretin complex InvH-InvG by NMR spectroscopy
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.1 % (1335 of 1532) | 83.2 % (668 of 803) | 91.8 % (535 of 583) | 90.4 % (132 of 146) |
Backbone | 87.2 % (668 of 766) | 80.4 % (209 of 260) | 90.0 % (343 of 381) | 92.8 % (116 of 125) |
Sidechain | 87.4 % (777 of 889) | 83.4 % (453 of 543) | 94.8 % (308 of 325) | 76.2 % (16 of 21) |
Aromatic | 96.4 % (108 of 112) | 96.4 % (54 of 56) | 96.3 % (52 of 54) | 100.0 % (2 of 2) |
Methyl | 95.7 % (111 of 116) | 91.4 % (53 of 58) | 100.0 % (58 of 58) |
1. entity 1
GSHMDNSASK NSAISSSIFC EKYKQTKEQA LTFFQEHPQY MRSKEDEEQL MTEFKKVLLE PGSKNLSIYQ TLLAAHERLQ AL2. entity 2
GSHMDPLTPD ASESVNNILK QSGAWSGDDK LQKWVRVYLD RGQEAIKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
3 | MOPS | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | TCEP | natural abundance | 0.2 mM | |
6 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 20 mM NA- MOPS, 150 mM NA- sodium chloride, 0.2 mM NA- TCEP, 10 % v/v NA- D2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-13C; U-15N] | 0.5 mM | |
8 | entity_2 | [U-13C; U-15N] | 0.5 mM | |
9 | MOPS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | TCEP | natural abundance | 0.2 mM | |
12 | D2O | natural abundance | 10 % v/v |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30765_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80-- GSHMDNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQAL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MDNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQAL
--------10--------20--------30--------40------- GSHMDPLTPDASESVNNILKQSGAWSGDDKLQKWVRVYLDRGQEAIK ||||||||||||||||||||||||||||||||||||||||||||| ..HMDPLTPDASESVNNILKQSGAWSGDDKLQKWVRVYLDRGQEAIK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 520 | 498 | 95.8 |
13C chemical shifts | 378 | 361 | 95.5 |
15N chemical shifts | 92 | 85 | 92.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 164 | 156 | 95.1 |
13C chemical shifts | 164 | 154 | 93.9 |
15N chemical shifts | 80 | 76 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 356 | 342 | 96.1 |
13C chemical shifts | 214 | 207 | 96.7 |
15N chemical shifts | 12 | 9 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 36 | 92.3 |
13C chemical shifts | 39 | 36 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 36 | 94.7 |
13C chemical shifts | 38 | 36 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 283 | 262 | 92.6 |
13C chemical shifts | 205 | 190 | 92.7 |
15N chemical shifts | 54 | 49 | 90.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 88 | 91.7 |
13C chemical shifts | 94 | 85 | 90.4 |
15N chemical shifts | 45 | 42 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 187 | 174 | 93.0 |
13C chemical shifts | 111 | 105 | 94.6 |
15N chemical shifts | 9 | 7 | 77.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 23 | 22 | 95.7 |
13C chemical shifts | 23 | 22 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 18 | 100.0 |
13C chemical shifts | 16 | 16 | 100.0 |
15N chemical shifts | 2 | 2 | 100.0 |