The isolated chicken ASIC1a thumb domain (ATD-c1a) retains the structure and ligand binding properties of the full length chicken ASIC1a
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS2:SG | 1:CYS77:SG |
2 | disulfide | sing | 1:CYS20:SG | 1:CYS73:SG |
3 | disulfide | sing | 1:CYS24:SG | 1:CYS71:SG |
4 | disulfide | sing | 1:CYS33:SG | 1:CYS55:SG |
5 | disulfide | sing | 1:CYS35:SG | 1:CYS47:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.9 % (741 of 863) | 80.4 % (358 of 445) | 89.9 % (303 of 337) | 98.8 % (80 of 81) |
Backbone | 87.3 % (400 of 458) | 79.1 % (121 of 153) | 89.7 % (208 of 232) | 97.3 % (71 of 73) |
Sidechain | 85.2 % (410 of 481) | 81.2 % (237 of 292) | 91.2 % (165 of 181) | 100.0 % (8 of 8) |
Aromatic | 81.9 % (59 of 72) | 75.0 % (27 of 36) | 88.9 % (32 of 36) | |
Methyl | 69.0 % (40 of 58) | 55.2 % (16 of 29) | 82.8 % (24 of 29) |
1. entity 1
SCKATTGDSE FYDTYSITAC RIDCETRYLV ENCNCRMVHM PGDAPYCTPE QYKECADPAL DFLVEKDNEY CVCEMPCNSolvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz The instrument is fitted with a triple-resonance TCI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.0 (±0.05), Details 320 uM [U-100% 13C; U-100% 15N] Thumb domain of the chicken acid-sensing ion channel 1a (cASIC1a), 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Acid-sensing ion channel 1 | [U-100% 13C; U-100% 15N] | 320 uM | |
2 | Bis-Tris | natural abundance | 50 mM |
Properties
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:2:CYS:SG | 1:77:CYS:SG | oxidized, CA 55.375, CB 42.198 ppm | oxidized, CA 55.293, CB 41.678 ppm | n/a |
1:20:CYS:SG | 1:73:CYS:SG | oxidized, CA 59.736, CB 40.242 ppm | oxidized, CA 53.753, CB 41.707 ppm | n/a |
1:24:CYS:SG | 1:71:CYS:SG | oxidized, CA 59.277, CB 42.716 ppm | oxidized, CA 54.148, CB 40.122 ppm | n/a |
1:33:CYS:SG | 1:55:CYS:SG | oxidized, CA 52.852, CB 41.176 ppm | oxidized, CA 59.296, CB 42.25 ppm | n/a |
1:35:CYS:SG | 1:47:CYS:SG | oxidized, CA 54.538, CB 44.572 ppm | oxidized, CA 55.019, CB 40.837 ppm | n/a |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30850_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70-------- SCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .CKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCN
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
8 | ASP | CG | 177.466 |
10 | GLU | CD | 181.155 |
13 | ASP | CG | 177.256 |
23 | ASP | CG | 176.493 |
25 | GLU | CD | 178.821 |
31 | GLU | CD | 180.95 |
43 | ASP | CG | 178.07 |
48 | THR | HG1 | 5.789 |
50 | GLU | CD | 181.779 |
54 | GLU | CD | 180.544 |
57 | ASP | CG | 175.966 |
67 | ASP | CG | 177.292 |
69 | GLU | CD | 181.247 |
74 | GLU | CD | 180.875 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 445 | 437 | 98.2 |
13C chemical shifts | 337 | 329 | 97.6 |
15N chemical shifts | 81 | 80 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 153 | 151 | 98.7 |
13C chemical shifts | 156 | 153 | 98.1 |
15N chemical shifts | 73 | 72 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 292 | 286 | 97.9 |
13C chemical shifts | 181 | 176 | 97.2 |
15N chemical shifts | 8 | 8 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 32 | 100.0 |
13C chemical shifts | 32 | 32 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 32 | 88.9 |
13C chemical shifts | 36 | 32 | 88.9 |