AUGalpha - FAM150B - ALKL2 77-152
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS35:SG | 1:CYS71:SG |
2 | disulfide | sing | 1:CYS49:SG | 1:CYS58:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.2 % (785 of 944) | 88.9 % (442 of 497) | 75.7 % (278 of 367) | 81.3 % (65 of 80) |
Backbone | 78.3 % (346 of 442) | 93.2 % (137 of 147) | 63.7 % (144 of 226) | 94.2 % (65 of 69) |
Sidechain | 88.0 % (507 of 576) | 87.1 % (305 of 350) | 94.0 % (202 of 215) | 0.0 % (0 of 11) |
Aromatic | 97.4 % (76 of 78) | 97.4 % (38 of 39) | 97.4 % (38 of 39) | |
Methyl | 100.0 % (70 of 70) | 100.0 % (35 of 35) | 100.0 % (35 of 35) |
1. entity 1
GPSPEQRVEI VPRDLRMKDK FLKHLTGPLY FSPKCSKHFH RLYHNTRDCT IPAYYKRCAR LLTRLAVSPV CMEDKQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM U-15N, U-1H,13C_CH3_AILMTV AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | AUGalpha-FAM150B- residues 77-152 | [U-15N; U-1H,13C_CH3_AILMTV] | 300 uM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM [U-100% 13C; U-100% 15N] AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AUGalpha-FAM150B- residues 77-152 | [U-100% 13C; U-100% 15N] | 300 uM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM U-15N, U-1H,13C_CH3_AILMTV AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | AUGalpha-FAM150B- residues 77-152 | [U-15N; U-1H,13C_CH3_AILMTV] | 300 uM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM U-15N, U-1H,13C_CH3_AILMTV AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | AUGalpha-FAM150B- residues 77-152 | [U-15N; U-1H,13C_CH3_AILMTV] | 300 uM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium azide | natural abundance | 0.1 % |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 300 uM U-15N, U-1H,13C_CH3_AILMTV AUGalpha-FAM150B- residues 77-152, 150 mM sodium chloride, 20 mM sodium phosphate, 0.1 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | AUGalpha-FAM150B- residues 77-152 | [U-15N; U-1H,13C_CH3_AILMTV] | 300 uM | |
6 | sodium chloride | natural abundance | 150 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium azide | natural abundance | 0.1 % |
Properties
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:35:CYS:SG | 1:71:CYS:SG | unknown, CA 58.0 ppm | oxidized, CA 55.25, CB 41.868 ppm | n/a |
1:49:CYS:SG | 1:58:CYS:SG | unknown, CA 54.413 ppm | oxidized, CA 59.63, CB 41.673 ppm | n/a |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr30911_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------ GPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ |||||||||||||||||||||||||||||| ||| ||||||||| ||||||||||||||||||||||||||||| .PSPEQRVEIVPRDLRMKDKFLKHLTGPLYF.PKC..HFHRLYHNT.DCTIPAYYKRCARLLTRLAVSPVCMEDKQ
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
38 | HIS | HD1 | 7.044 |
38 | HIS | ND1 | 171.369 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 497 | 438 | 88.1 |
13C chemical shifts | 367 | 271 | 73.8 |
15N chemical shifts | 80 | 64 | 80.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 147 | 135 | 91.8 |
13C chemical shifts | 152 | 70 | 46.1 |
15N chemical shifts | 69 | 64 | 92.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 350 | 303 | 86.6 |
13C chemical shifts | 215 | 201 | 93.5 |
15N chemical shifts | 11 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 37 | 100.0 |
13C chemical shifts | 37 | 37 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 38 | 97.4 |
13C chemical shifts | 39 | 38 | 97.4 |