NMR structure of the C-terminal domain of the Bacteriophage T5 decoration protein pb10
ALTLSKDLTA SMSVEEGAAL TLSVTATGGT GPYTYAWTKD GSPIPDASGA TYTKPTAAAE DAGSYKVTVT DSKQVSKDST TCAVTVNPTV PGGLEHHHHH H
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.4 % (943 of 1032) | 90.9 % (469 of 516) | 91.4 % (382 of 418) | 93.9 % (92 of 98) |
Backbone | 94.3 % (560 of 594) | 94.1 % (193 of 205) | 94.6 % (278 of 294) | 93.7 % (89 of 95) |
Sidechain | 88.7 % (470 of 530) | 88.7 % (276 of 311) | 88.4 % (191 of 216) | 100.0 % (3 of 3) |
Aromatic | 70.6 % (48 of 68) | 70.6 % (24 of 34) | 69.7 % (23 of 33) | 100.0 % (1 of 1) |
Methyl | 98.3 % (118 of 120) | 100.0 % (60 of 60) | 96.7 % (58 of 60) |
1. Decoration protein
ALTLSKDLTA SMSVEEGAAL TLSVTATGGT GPYTYAWTKD GSPIPDASGA TYTKPTAAAE DAGSYKVTVT DSKQVSKDST TCAVTVNPTV PGGLEHHHHH HSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker DRX(600) - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX(700) - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX(700) - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX(700) - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX(700) - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX(700) - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX(700) - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX(700) - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX(700) - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX(700) - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details 200 uM [U-99% 13C; U-99% 15N] c72, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | c72 | [U-99% 13C; U-99% 15N] | 200 uM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34046_5lxk.nef |
Input source #2: Coordindates | 5lxk.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------80--------90-------100-------110-------120-------130-------140-------150-------160-------170- ALTLSKDLTASMSVEEGAALTLSVTATGGTGPYTYAWTKDGSPIPDASGATYTKPTAAAEDAGSYKVTVTDSKQVSKDSTTCAVTVNPTVPGGLEHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALTLSKDLTASMSVEEGAALTLSVTATGGTGPYTYAWTKDGSPIPDASGATYTKPTAAAEDAGSYKVTVTDSKQVSKDSTTCAVTVNPTVPGGLEHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 - H | H -
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 101 | 0 | 0 | 100.0 |
Content subtype: combined_34046_5lxk.nef
Assigned chemical shifts
-------80--------90-------100-------110-------120-------130-------140-------150-------160-------170- ALTLSKDLTASMSVEEGAALTLSVTATGGTGPYTYAWTKDGSPIPDASGATYTKPTAAAEDAGSYKVTVTDSKQVSKDSTTCAVTVNPTVPGGLEHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALTLSKDLTASMSVEEGAALTLSVTATGGTGPYTYAWTKDGSPIPDASGATYTKPTAAAEDAGSYKVTVTDSKQVSKDSTTCAVTVNPTVPGGLEH -------80--------90-------100-------110-------120-------130-------140-------150-------160------- - H
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
145 | GLN | CD | 180.647 |
158 | ASN | CG | 175.975 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 516 | 462 | 89.5 |
13C chemical shifts | 418 | 379 | 90.7 |
15N chemical shifts | 98 | 91 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 205 | 189 | 92.2 |
13C chemical shifts | 202 | 190 | 94.1 |
15N chemical shifts | 95 | 88 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 311 | 273 | 87.8 |
13C chemical shifts | 216 | 189 | 87.5 |
15N chemical shifts | 3 | 3 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 60 | 98.4 |
13C chemical shifts | 61 | 58 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 22 | 64.7 |
13C chemical shifts | 33 | 21 | 63.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-------80--------90-------100-------110-------120-------130-------140-------150-------160-------170- ALTLSKDLTASMSVEEGAALTLSVTATGGTGPYTYAWTKDGSPIPDASGATYTKPTAAAEDAGSYKVTVTDSKQVSKDSTTCAVTVNPTVPGGLEHHHHH |||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALTLSKDLTASMSVEEGAALTLSVTATGGT.PYTYAWTKDGSPIPDASGATYTKPTAAAEDAGSYKVTVTDSKQVSKDSTTCAVTVNPTVPGGLEH -------80--------90-------100-------110-------120-------130-------140-------150-------160------- - H
Dihedral angle restraints
-------80--------90-------100-------110-------120-------130-------140-------150-------160-------170- ALTLSKDLTASMSVEEGAALTLSVTATGGTGPYTYAWTKDGSPIPDASGATYTKPTAAAEDAGSYKVTVTDSKQVSKDSTTCAVTVNPTVPGGLEHHHHH ||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| ALTLSKDLTASMSVEEGAALTLSVTATGGTGPYTYAWTKDGSPIP.....TYTKPTAAAEDAGSYKVTVTDSKQVSKDSTTCAVTVNPTVPG -------80--------90-------100-------110-------120-------130-------140-------150-------160--- - H