RBM5 OCRE domain
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.6 % (694 of 734) | 92.5 % (347 of 375) | 96.2 % (281 of 292) | 98.5 % (66 of 67) |
Backbone | 95.5 % (359 of 376) | 94.6 % (122 of 129) | 95.2 % (178 of 187) | 98.3 % (59 of 60) |
Sidechain | 94.5 % (394 of 417) | 91.5 % (225 of 246) | 98.8 % (162 of 164) | 100.0 % (7 of 7) |
Aromatic | 100.0 % (124 of 124) | 100.0 % (62 of 62) | 100.0 % (61 of 61) | 100.0 % (1 of 1) |
Methyl | 83.3 % (35 of 42) | 76.2 % (16 of 21) | 90.5 % (19 of 21) |
1. entity 1
GAMGTKYAVP DTSTYQYDES SGYYYDPTTG LYYDPNSQYY YNSLTQQYLY WDGEKETYVP AAESSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Bruker AvanceIII - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-100% 13C; U-100% 15N] ocre5, 20 mM sodium phosphate, 50 mM sodium chloride, 10 % D2O, 90 % H2O, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | H2O | natural abundance | 90 % | |
3 | ocre5 | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_34068_5mfy.nef |
Input source #2: Coordindates | 5mfy.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60---- GAMGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAES |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAES
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 64 | 0 | 0 | 100.0 |
Content subtype: combined_34068_5mfy.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60---- GAMGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAES |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAES
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 375 | 357 | 95.2 |
13C chemical shifts | 292 | 282 | 96.6 |
15N chemical shifts | 67 | 65 | 97.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 129 | 125 | 96.9 |
13C chemical shifts | 128 | 120 | 93.8 |
15N chemical shifts | 60 | 58 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 246 | 232 | 94.3 |
13C chemical shifts | 164 | 162 | 98.8 |
15N chemical shifts | 7 | 7 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 20 | 90.9 |
13C chemical shifts | 22 | 20 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 62 | 100.0 |
13C chemical shifts | 61 | 61 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60---- GAMGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAES || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AM.TKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAE --------10--------20--------30--------40--------50--------60---