NMR structure of the free helix bundle domain from the functional pRN1 primase
TVVEFEELRK ELVKRDSGKP VEKIKEEICT KSPPKLIKEI ICENKTYADV NIDRSRGDWH VILYLMKHGV TDPDKILELL PRDSKAKENE KWNTQKYFVI TLSKAWSVVK KYLEA
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS29:SG | 1:CYS42:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 74.1 % (1064 of 1435) | 75.7 % (573 of 757) | 69.1 % (387 of 560) | 88.1 % (104 of 118) |
Backbone | 71.5 % (486 of 680) | 78.1 % (178 of 228) | 60.5 % (207 of 342) | 91.8 % (101 of 110) |
Sidechain | 77.6 % (673 of 867) | 74.7 % (395 of 529) | 83.3 % (275 of 330) | 37.5 % (3 of 8) |
Aromatic | 87.5 % (84 of 96) | 89.6 % (43 of 48) | 84.4 % (38 of 45) | 100.0 % (3 of 3) |
Methyl | 91.2 % (124 of 136) | 91.2 % (62 of 68) | 91.2 % (62 of 68) |
1. entity 1
TVVEFEELRK ELVKRDSGKP VEKIKEEICT KSPPKLIKEI ICENKTYADV NIDRSRGDWH VILYLMKHGV TDPDKILELL PRDSKAKENE KWNTQKYFVI TLSKAWSVVK KYLEASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.2 mM [U-99% 13C; U-99% 15N] helix bundle domain, 0.9 mM [U-99% 15N] helix bundle domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 13C, 15N helix bundle domain | [U-99% 13C; U-99% 15N] | 1.2 mM | |
2 | 15N helix bundle domain | [U-99% 15N] | 0.9 mM | |
3 | NaCl | natural abundance | 50 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.7 mM [U-100% 13C] helix bundle domain, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | 13C helix bundle domain | [U-100% 13C] | 0.7 mM | |
5 | NaCl | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.7 ppm | internal | direct | 1.0 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 4.7 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.7 ppm | internal | direct | 1.0 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 4.7 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.7 ppm | internal | direct | 1.0 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 4.7 ppm | internal | direct | 1.0 |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.2 mM [U-99% 13C; U-99% 15N] helix bundle domain, 0.9 mM [U-99% 15N] helix bundle domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 13C, 15N helix bundle domain | [U-99% 13C; U-99% 15N] | 1.2 mM | |
2 | 15N helix bundle domain | [U-99% 15N] | 0.9 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.2 mM [U-99% 13C; U-99% 15N] helix bundle domain, 0.9 mM [U-99% 15N] helix bundle domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 13C, 15N helix bundle domain | [U-99% 13C; U-99% 15N] | 1.2 mM | |
2 | 15N helix bundle domain | [U-99% 15N] | 0.9 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.2 mM [U-99% 13C; U-99% 15N] helix bundle domain, 0.9 mM [U-99% 15N] helix bundle domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 13C, 15N helix bundle domain | [U-99% 13C; U-99% 15N] | 1.2 mM | |
2 | 15N helix bundle domain | [U-99% 15N] | 0.9 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.7 mM [U-100% 13C] helix bundle domain, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | 13C helix bundle domain | [U-100% 13C] | 0.7 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.7 mM [U-100% 13C] helix bundle domain, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | 13C helix bundle domain | [U-100% 13C] | 0.7 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.2 mM [U-99% 13C; U-99% 15N] helix bundle domain, 0.9 mM [U-99% 15N] helix bundle domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 13C, 15N helix bundle domain | [U-99% 13C; U-99% 15N] | 1.2 mM | |
2 | 15N helix bundle domain | [U-99% 15N] | 0.9 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker AVANCE III - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.2 mM [U-99% 13C; U-99% 15N] helix bundle domain, 0.9 mM [U-99% 15N] helix bundle domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 13C, 15N helix bundle domain | [U-99% 13C; U-99% 15N] | 1.2 mM | |
2 | 15N helix bundle domain | [U-99% 15N] | 0.9 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker AVANCE III - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.2 mM [U-99% 13C; U-99% 15N] helix bundle domain, 0.9 mM [U-99% 15N] helix bundle domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 13C, 15N helix bundle domain | [U-99% 13C; U-99% 15N] | 1.2 mM | |
2 | 15N helix bundle domain | [U-99% 15N] | 0.9 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker AVANCE III - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.2 mM [U-99% 13C; U-99% 15N] helix bundle domain, 0.9 mM [U-99% 15N] helix bundle domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 13C, 15N helix bundle domain | [U-99% 13C; U-99% 15N] | 1.2 mM | |
2 | 15N helix bundle domain | [U-99% 15N] | 0.9 mM | |
3 | NaCl | natural abundance | 50 mM |
Bruker AVANCE III - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1.2 mM [U-99% 13C; U-99% 15N] helix bundle domain, 0.9 mM [U-99% 15N] helix bundle domain, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 13C, 15N helix bundle domain | [U-99% 13C; U-99% 15N] | 1.2 mM | |
2 | 15N helix bundle domain | [U-99% 15N] | 0.9 mM | |
3 | NaCl | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34287_6gt7.nef |
Input source #2: Coordindates | 6gt7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:284:CYS:SG | A:297:CYS:SG | oxidized, CA 58.35, CB 40.865 ppm | oxidized, CB 38.934 ppm | 2.038 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--260-------270-------280-------290-------300-------310-------320-------330-------340-------350----- TVVEFEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TVVEFEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --360-------370 TLSKAWSVVKKYLEA ||||||||||||||| TLSKAWSVVKKYLEA -------110-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 115 | 0 | 0 | 100.0 |
Content subtype: combined_34287_6gt7.nef
Assigned chemical shifts
--260-------270-------280-------290-------300-------310-------320-------330-------340-------350----- TVVEFEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVI ||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TVVEFEELRKELVKRDSGKPVEKIKEEICTK.....I.EIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVI --360-------370 TLSKAWSVVKKYLEA ||||||||||||||| TLSKAWSVVKKYLEA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 560 | 370 | 66.1 |
1H chemical shifts | 757 | 567 | 74.9 |
15N chemical shifts | 123 | 102 | 82.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 230 | 97 | 42.2 |
1H chemical shifts | 228 | 178 | 78.1 |
15N chemical shifts | 110 | 99 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 330 | 273 | 82.7 |
1H chemical shifts | 529 | 389 | 73.5 |
15N chemical shifts | 13 | 3 | 23.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 69 | 63 | 91.3 |
1H chemical shifts | 69 | 63 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 45 | 38 | 84.4 |
1H chemical shifts | 48 | 43 | 89.6 |
15N chemical shifts | 3 | 3 | 100.0 |
Covalent bonds
Distance restraints
--260-------270-------280-------290-------300-------310-------320-------330-------340-------350----- TVVEFEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVI ||||||||||||||||||||||||||||||| | ||||||||||||||| ||||||||||||||||||||||||||||||||| | |||||||| TVVEFEELRKELVKRDSGKPVEKIKEEICTK.....I..IICENKTYADVNIDR.RGDWHVILYLMKHGVTDPDKILELLPRDSKAKE.E..NTQKYFVI --260-------270-------280-------290-------300-------310-------320-------330-------340-------350----- --360-------370 TLSKAWSVVKKYLEA |||||||||||||| TLSKAWSVVKKYLE --360---------
--260-------270-------280-------290-------300-------310-------320-------330-------340-------350----- TVVEFEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVI | || ||||| | |||||| ||| || || || |||| | |||| ||||| ||||| | ||| || | | .......L..EL.KRDSG..V.KIKEEI.TKS...LI..II....TY......RSRG.W.VILY..KHGVT...KILEL.P.DSK.........QK.F.I --360-------370 TLSKAWSVVKKYLEA ||||||||| ||| | TLSKAWSVV.KYL.A
--260-------270-------280-------290-------300-------310-------320-------330-------340-------350----- TVVEFEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVI ||||||||||||||| | |||||||| |||||||| ||||||||||||||| ||| ||| |||||||||| TVVEFEELRKELVKR.....V.KIKEEICT....KLIKEIIC...........RSRGDWHVILYLMKH....PDK.LEL...........KWNTQKYFVI --260-------270-------280-------290-------300-------310-------320-------330-------340-------350----- --360-------370 TLSKAWSVVKKYLEA |||||||||||||| TLSKAWSVVKKYLE --360---------
Dihedral angle restraints
--260-------270-------280-------290-------300-------310-------320-------330-------340-------350----- TVVEFEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVI ||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| TVVEFEELRKELVKRDSGKPVEKIKEEICTK.......EIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAK.....NTQKYFVI --260-------270-------280-------290-------300-------310-------320-------330-------340-------350----- --360-------370 TLSKAWSVVKKYLEA |||||||||||||| TLSKAWSVVKKYLE --360---------