Cadmium(II) form of A44H mutant of shortened metallothionein from Pseudomonas fluorescens Q2-87 (residues 1-52)
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | metal coordination | sing | 1:CYS7:SG | 2:CD1:CD |
2 | metal coordination | sing | 1:CYS32:SG | 2:CD1:CD |
3 | metal coordination | sing | 1:HIS36:NE2 | 2:CD1:CD |
4 | metal coordination | sing | 1:CYS49:SG | 2:CD1:CD |
5 | metal coordination | sing | 1:CYS10:SG | 2:CD1:CD |
6 | metal coordination | sing | 1:CYS42:SG | 2:CD1:CD |
7 | metal coordination | sing | 1:CYS47:SG | 2:CD1:CD |
8 | metal coordination | sing | 1:CYS49:SG | 2:CD1:CD |
9 | metal coordination | sing | 1:CYS12:SG | 2:CD1:CD |
10 | metal coordination | sing | 1:CYS28:SG | 2:CD1:CD |
11 | metal coordination | sing | 1:CYS42:SG | 2:CD1:CD |
12 | metal coordination | sing | 1:HIS44:ND1 | 2:CD1:CD |
13 | metal coordination | sing | 1:CYS5:SG | 2:CD1:CD |
14 | metal coordination | sing | 1:CYS10:SG | 2:CD1:CD |
15 | metal coordination | sing | 1:CYS28:SG | 2:CD1:CD |
16 | metal coordination | sing | 1:CYS32:SG | 2:CD1:CD |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.5 % (525 of 550) | 95.9 % (279 of 291) | 97.6 % (203 of 208) | 84.3 % (43 of 51) |
Backbone | 93.7 % (281 of 300) | 92.1 % (93 of 101) | 98.0 % (150 of 153) | 82.6 % (38 of 46) |
Sidechain | 98.0 % (293 of 299) | 97.9 % (186 of 190) | 98.1 % (102 of 104) | 100.0 % (5 of 5) |
Aromatic | 92.1 % (35 of 38) | 94.7 % (18 of 19) | 89.5 % (17 of 19) | |
Methyl | 77.8 % (14 of 18) | 77.8 % (7 of 9) | 77.8 % (7 of 9) |
1. entity 1
NELRCGCPDC HCKVDPERVF NHDGEAYCSQ ACAEQHPNGE PCPHPDCHCE RSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 1 mM metallothionein, 4 mM [U-113Cd] CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | metallothionein | natural abundance | 1 (±0.1) mM | |
6 | CADMIUM ION | [U-113Cd] | 4 (±0.1) mM | |
7 | TRIS | [U-2H] | 50 (±1.0) mM | |
8 | sodium chloride | natural abundance | 50 (±1.0) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 ppm | external | indirect | 0.1013291 |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 700 MHz CRYO TXI inverse triple-resonance (1H; 13C; 15N) with an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 700 MHz CRYO TXI inverse triple-resonance (1H; 13C; 15N) with an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 700 MHz CRYO TXI inverse triple-resonance (1H; 13C; 15N) with an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.1), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | CADMIUM ION | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker AvanceII - 500 MHz CRYO 5 mm QNP (1H,13C,31P,19F) with an actively shielded z-gradient coil and ATM
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 7.4 (±0.1), Details 1 mM metallothionein, 4 mM [U-113Cd] CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | metallothionein | natural abundance | 1 (±0.1) mM | |
6 | CADMIUM ION | [U-113Cd] | 4 (±0.1) mM | |
7 | TRIS | [U-2H] | 50 (±1.0) mM | |
8 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker AvanceII - 500 MHz CRYO 5 mm QNP (1H,13C,31P,19F) with an actively shielded z-gradient coil and ATM
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 7.4 (±0.1), Details 1 mM metallothionein, 4 mM [U-113Cd] CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | metallothionein | natural abundance | 1 (±0.1) mM | |
6 | CADMIUM ION | [U-113Cd] | 4 (±0.1) mM | |
7 | TRIS | [U-2H] | 50 (±1.0) mM | |
8 | sodium chloride | natural abundance | 50 (±1.0) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34289_6gv7.nef |
Input source #2: Coordindates | 6gv7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:5:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:7:CYS:SG | 2:1:CD:CD | unknown | unknown | n/a |
1:10:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:10:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:12:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:28:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:28:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:32:CYS:SG | 2:1:CD:CD | unknown | unknown | n/a |
1:32:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:36:HIS:NE2 | 2:1:CD:CD | unknown | unknown | n/a |
1:42:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:42:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:44:HIS:ND1 | 2:3:CD:CD | unknown | unknown | n/a |
1:47:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:49:CYS:SG | 2:1:CD:CD | unknown | unknown | n/a |
1:49:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CD | CADMIUM ION | None |
B | 2 | CD | CADMIUM ION | None |
B | 3 | CD | CADMIUM ION | None |
B | 4 | CD | CADMIUM ION | None |
Sequence alignments
--------10--------20--------30--------40--------50-- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS |||||||||||||||||||||||||||||||||||||||||||||||||||| NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 52 | 0 | 0 | 100.0 |
Content subtype: combined_34289_6gv7.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50-- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS |||||||||||||||||||||||||||||||||||||||||||||||||||| NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
11 | HIS | ND1 | 222.254 |
11 | HIS | NE2 | 175.15 |
22 | HIS | ND1 | 223.433 |
22 | HIS | NE2 | 175.905 |
36 | HIS | ND1 | 173.056 |
36 | HIS | NE2 | 225.385 |
44 | HIS | ND1 | 224.859 |
44 | HIS | NE2 | 172.305 |
48 | HIS | ND1 | 190.978 |
48 | HIS | NE2 | 183.725 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 291 | 279 | 95.9 |
13C chemical shifts | 208 | 203 | 97.6 |
15N chemical shifts | 54 | 43 | 79.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 101 | 93 | 92.1 |
13C chemical shifts | 104 | 101 | 97.1 |
15N chemical shifts | 46 | 38 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 190 | 186 | 97.9 |
13C chemical shifts | 104 | 102 | 98.1 |
15N chemical shifts | 8 | 5 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 9 | 9 | 100.0 |
13C chemical shifts | 9 | 9 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 19 | 18 | 94.7 |
13C chemical shifts | 19 | 17 | 89.5 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50-- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS ||||||||||||||||||||||||||||||||||||||||||||||||||| .ELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS
Dihedral angle restraints
--------10--------20--------30--------40--------50-- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS |||||||||||||||||||||||||||||||||||||||||||||| ||| .ELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDC..ERS