BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	85.4 % (636 of 745)	90.8 % (355 of 391)	76.6 % (226 of 295)	93.2 % (55 of 59)
Backbone	81.1 % (284 of 350)	94.9 % (112 of 118)	66.9 % (117 of 175)	96.5 % (55 of 57)
Sidechain	90.0 % (407 of 452)	89.0 % (243 of 273)	92.7 % (164 of 177)	0.0 % (0 of 2)
Aromatic	78.9 % (60 of 76)	78.9 % (30 of 38)	78.9 % (30 of 38)
Methyl	100.0 % (62 of 62)	100.0 % (31 of 31)	100.0 % (31 of 31)

1. entity 1

MLKDYHLKEM PEMEDEFLEY CAKNPSYEEA YLKFGDKLLE YELLGKIKRI NHIVVLAHH

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 128 uM 15N,13C HpDprA CTD, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HpDprA CTD	[U-15N; U-13C]	128 uM
2	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
3	NaCl	natural abundance	50 mM

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 128 uM [U-13C; U-15N] C-terminal Domain of Helicobacter Pylori RecA-loader DNA Processing Protein A (DprA), 100% D2O

#	Name	Isotope labeling	Concentration
4	HpDprA CTD	[U-13C; U-15N]	128 uM
5	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
6	NaCl	natural abundance	50 mM

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 34 uM [U-15N] C-terminal Domain of Helicobacter Pylori RecA-loader DNA Processing Protein A (DprA), 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
7	HpDprA CTD	[U-15N]	34 uM
8	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
9	NaCl	natural abundance	50 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.54 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.54 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.04 ppm, Outliers: 2 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 6GW7, Strand ID: A Detail

Release date

2019-04-17

Citation

The C-terminal domain of HpDprA is a DNA-binding winged helix domain that does not bind double-stranded DNA
Lisboa, J., Celma, L., Sanchez, D., Marquis, M., Andreani, J., Guerois, R., Ochsenbein, F., Durand, D., Marsin, S., Cuniasse, P., Radicella, J.P., Quevillon-Cheruel, S.
FEBS J. (2019), 286, 1941-1958, PubMed 30771270 , DOI 10.1111/febs.14788 , Abstract

Related entities 1. DNA protecting protein DprA, : 1 : 5 entities Detail

Experiments performed 8 experiments Detail

1 3D 1H-13C NOESY aliphatic

Instrument

Bruker Avance - 950 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 128 uM 15N,13C HpDprA CTD, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HpDprA CTD	[U-15N; U-13C]	128 uM
2	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
3	NaCl	natural abundance	50 mM

2 3D 1H-13C NOESY aromatic

Instrument

Bruker Avance - 950 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 128 uM 15N,13C HpDprA CTD, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HpDprA CTD	[U-15N; U-13C]	128 uM
2	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
3	NaCl	natural abundance	50 mM

3 3D 1H-15N NOESY

Instrument

Bruker Avance - 950 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 128 uM 15N,13C HpDprA CTD, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HpDprA CTD	[U-15N; U-13C]	128 uM
2	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
3	NaCl	natural abundance	50 mM

4 2D 1H-15N HSQC

Instrument

Bruker DRX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4, Details 34 uM [U-15N] C-terminal Domain of Helicobacter Pylori RecA-loader DNA Processing Protein A (DprA), 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
7	HpDprA CTD	[U-15N]	34 uM
8	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
9	NaCl	natural abundance	50 mM

5 3D 1H-15N TOCSY

Instrument

Bruker DRX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 128 uM 15N,13C HpDprA CTD, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HpDprA CTD	[U-15N; U-13C]	128 uM
2	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
3	NaCl	natural abundance	50 mM

6 3D HNCA

Instrument

Bruker DRX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 128 uM 15N,13C HpDprA CTD, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HpDprA CTD	[U-15N; U-13C]	128 uM
2	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
3	NaCl	natural abundance	50 mM

7 3D HBHA(CO)NH

Instrument

Bruker DRX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 128 uM 15N,13C HpDprA CTD, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HpDprA CTD	[U-15N; U-13C]	128 uM
2	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
3	NaCl	natural abundance	50 mM

8 3D CBCA(CO)NH

Instrument

Bruker DRX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.6, Details 128 uM 15N,13C HpDprA CTD, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HpDprA CTD	[U-15N; U-13C]	128 uM
2	Phosphate Buffer (NH2PO4)	natural abundance	20 mM
3	NaCl	natural abundance	50 mM

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_34292_6gw7.nef
Input source #2: Coordindates	6gw7.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50---------
MLKDYHLKEMPEMEDEFLEYCAKNPSYEEAYLKFGDKLLEYELLGKIKRINHIVVLAHH
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MLKDYHLKEMPEMEDEFLEYCAKNPSYEEAYLKFGDKLLEYELLGKIKRINHIVVLAHH

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	59	0	0	100.0

Content subtype: combined_34292_6gw7.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chemical_shifts_1	Warning	641		98.3 (chain: A, length: 59)
1	Distance restraints	CNS/XPLOR_distance_constraints_3	Warning	18 (1)	hbond	25.4 (chain: A, length: 59)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_4	OK	52 (52)	.	67.8 (chain: A, length: 59)

Assigned chemical shifts

Saveframe: assigned_chemical_shifts_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 59, Sequence coverage: 98.3%
- Total number of assignments
  - ¹H chemical shifts: 365
  - ¹³C chemical shifts: 221
  - ¹⁵N chemical shifts: 55
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	391	365	93.4
¹³C chemical shifts	295	221	74.9
¹⁵N chemical shifts	60	55	91.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	118	114	96.6
¹³C chemical shifts	118	57	48.3
¹⁵N chemical shifts	57	55	96.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	273	251	91.9
¹³C chemical shifts	177	164	92.7
¹⁵N chemical shifts	3	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	34	31	91.2
¹³C chemical shifts	34	31	91.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	38	30	78.9
¹³C chemical shifts	38	30	78.9

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_3
- Status: Warning
- Experiment type: hbond
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 59, Sequence coverage: 25.4%
- Total number of restraints: 18
- Weight of restraints: 1.0 (18)
- Potential type of restraints: square-well-parabolic (18)
- Range of distance target values: 2.1, 3.1 (Å)
- Histogram of distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 59, Sequence coverage: 67.8%
- Total number of restraints: 52
- Total number of restraints per polymer type: 52
- Weight of restraints: 1.0 (52)
- Potential type of restraints: square-well-parabolic (52)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords DNA BINDING PROTEIN, DprA, Helicobacter pylori, Winged Helix

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.641 seconds)

BMRB: 34292

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. DNA protecting protein DprA, : 1 : 5 entities Detail

Experiments performed 8 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail