Solution structure of Legionella pneumophila LspC
MAHHHHHHVD DDDKMTYVRA IPVSNTKSIA GMREENLNYI FNTSLFGVYV PADLNEDNVK QSMLNVTLVG ILFADKIEES QVIIRSASGE EKTYNVGDKI PGGATIKRIM PGGVLVERDG TLESLSLPKN DLTFEPVAKP LKEE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.2 % (1329 of 1657) | 79.3 % (679 of 856) | 82.1 % (532 of 648) | 77.1 % (118 of 153) |
Backbone | 86.7 % (737 of 850) | 83.8 % (244 of 291) | 88.9 % (375 of 422) | 86.1 % (118 of 137) |
Sidechain | 75.6 % (711 of 941) | 76.8 % (434 of 565) | 76.9 % (277 of 360) | 0.0 % (0 of 16) |
Aromatic | 35.4 % (34 of 96) | 66.7 % (32 of 48) | 4.2 % (2 of 48) | |
Methyl | 93.0 % (160 of 172) | 94.2 % (81 of 86) | 91.9 % (79 of 86) |
1. entity 1
MAHHHHHHVD DDDKMTYVRA IPVSNTKSIA GMREENLNYI FNTSLFGVYV PADLNEDNVK QSMLNVTLVG ILFADKIEES QVIIRSASGE EKTYNVGDKI PGGATIKRIM PGGVLVERDG TLESLSLPKN DLTFEPVAKP LKEESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-99% 13C; U-99% 15N] LspC-PER, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LspC-PER | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34627_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHVDDDDKMTYVRAIPVSNTKSIAGMREENLNYIFNTSLFGVYVPADLNEDNVKQSMLNVTLVGILFADKIEESQVIIRSASGEEKTYNVGDKI || |||||||||||||||| | ||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| .AH....HVDDDDKMTYVRAIPV..T..IAGMREENLNYIF..SLFGVYVPADLNEDNVKQSMLNVTLVGILFADKIEESQVIIRS.SGEEKTYNVGDKI -------110-------120-------130-------140---- PGGATIKRIMPGGVLVERDGTLESLSLPKNDLTFEPVAKPLKEE ||||||||||||||||||||||||||||||||||||||||||| .GGATIKRIMPGGVLVERDGTLESLSLPKNDLTFEPVAKPLKEE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 648 | 529 | 81.6 |
1H chemical shifts | 856 | 680 | 79.4 |
15N chemical shifts | 153 | 115 | 75.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 288 | 253 | 87.8 |
1H chemical shifts | 291 | 242 | 83.2 |
15N chemical shifts | 137 | 115 | 83.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 360 | 276 | 76.7 |
1H chemical shifts | 565 | 438 | 77.5 |
15N chemical shifts | 16 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 91 | 80 | 87.9 |
1H chemical shifts | 91 | 80 | 87.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 48 | 2 | 4.2 |
1H chemical shifts | 48 | 32 | 66.7 |