Structure of the human UFC1 protein in complex with the UBA5 C-terminal UFC1-binding motif.
MADEATRRVV SEIPVLKTNA GPRDRELWVQ RLKEEYQSLI RYVENNKNAD NDWFRLESNK EGTRWFGKCW YIHDLLKYEF DIEFDIPITY PTTAPEIAVP ELDGKTAKMY RGGKICLTDH FKPLWARNVP KFGLAHLMAL GLGPWLAVEI PDLIQKGVIQ HKEKCNQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.9 % (2049 of 2357) | 95.4 % (1172 of 1228) | 74.3 % (679 of 914) | 92.1 % (198 of 215) |
Backbone | 80.9 % (925 of 1144) | 95.9 % (374 of 390) | 65.6 % (374 of 570) | 96.2 % (177 of 184) |
Sidechain | 93.3 % (1302 of 1395) | 95.2 % (798 of 838) | 91.8 % (483 of 526) | 67.7 % (21 of 31) |
Aromatic | 81.3 % (169 of 208) | 91.3 % (95 of 104) | 69.1 % (67 of 97) | 100.0 % (7 of 7) |
Methyl | 98.1 % (204 of 208) | 98.1 % (102 of 104) | 98.1 % (102 of 104) |
1. entity 1
MADEATRRVV SEIPVLKTNA GPRDRELWVQ RLKEEYQSLI RYVENNKNAD NDWFRLESNK EGTRWFGKCW YIHDLLKYEF DIEFDIPITY PTTAPEIAVP ELDGKTAKMY RGGKICLTDH FKPLWARNVP KFGLAHLMAL GLGPWLAVEI PDLIQKGVIQ HKEKCNQ2. entity 2
GMSVTELTVE DSGESLEDLM AKMKNMWSolvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.2 mM Ubiquitin-fold modifier-conjugating enzyme 1, 0.3 mM [U-100% 13C; U-100% 15N] Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Ubiquitin-fold modifier-conjugating enzyme 1 | natural abundance | 1.2 (±0.05) mM | |
9 | Ubiquitin-like modifier-activating enzyme 5 | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
10 | TRIS | natural abundance | 50 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±1.0) mM | |
12 | TCEP | natural abundance | 2 (±0.1) mM | |
13 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
14 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III HD - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III HD - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.0 mM [U-100% 13C; U-100% 15N] Ubiquitin-fold modifier-conjugating enzyme 1, 1.0 mM Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin-fold modifier-conjugating enzyme 1 | [U-100% 13C; U-100% 15N] | 1.0 (±0.05) mM | |
2 | Ubiquitin-like modifier-activating enzyme 5 | natural abundance | 1.0 (±0.05) mM | |
3 | TRIS | natural abundance | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 100 (±1.0) mM | |
5 | TCEP | natural abundance | 2 (±0.1) mM | |
6 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
7 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.2 mM Ubiquitin-fold modifier-conjugating enzyme 1, 0.3 mM [U-100% 13C; U-100% 15N] Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Ubiquitin-fold modifier-conjugating enzyme 1 | natural abundance | 1.2 (±0.05) mM | |
9 | Ubiquitin-like modifier-activating enzyme 5 | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
10 | TRIS | natural abundance | 50 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±1.0) mM | |
12 | TCEP | natural abundance | 2 (±0.1) mM | |
13 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
14 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.2 mM Ubiquitin-fold modifier-conjugating enzyme 1, 0.3 mM [U-100% 13C; U-100% 15N] Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Ubiquitin-fold modifier-conjugating enzyme 1 | natural abundance | 1.2 (±0.05) mM | |
9 | Ubiquitin-like modifier-activating enzyme 5 | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
10 | TRIS | natural abundance | 50 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±1.0) mM | |
12 | TCEP | natural abundance | 2 (±0.1) mM | |
13 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
14 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.2 mM Ubiquitin-fold modifier-conjugating enzyme 1, 0.3 mM [U-100% 13C; U-100% 15N] Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Ubiquitin-fold modifier-conjugating enzyme 1 | natural abundance | 1.2 (±0.05) mM | |
9 | Ubiquitin-like modifier-activating enzyme 5 | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
10 | TRIS | natural abundance | 50 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±1.0) mM | |
12 | TCEP | natural abundance | 2 (±0.1) mM | |
13 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
14 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III HD - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.2 mM Ubiquitin-fold modifier-conjugating enzyme 1, 0.3 mM [U-100% 13C; U-100% 15N] Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Ubiquitin-fold modifier-conjugating enzyme 1 | natural abundance | 1.2 (±0.05) mM | |
9 | Ubiquitin-like modifier-activating enzyme 5 | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
10 | TRIS | natural abundance | 50 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±1.0) mM | |
12 | TCEP | natural abundance | 2 (±0.1) mM | |
13 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
14 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE NEO - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.2 mM Ubiquitin-fold modifier-conjugating enzyme 1, 0.3 mM [U-100% 13C; U-100% 15N] Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Ubiquitin-fold modifier-conjugating enzyme 1 | natural abundance | 1.2 (±0.05) mM | |
9 | Ubiquitin-like modifier-activating enzyme 5 | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
10 | TRIS | natural abundance | 50 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±1.0) mM | |
12 | TCEP | natural abundance | 2 (±0.1) mM | |
13 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
14 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE II - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.2 mM Ubiquitin-fold modifier-conjugating enzyme 1, 0.3 mM [U-100% 13C; U-100% 15N] Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Ubiquitin-fold modifier-conjugating enzyme 1 | natural abundance | 1.2 (±0.05) mM | |
9 | Ubiquitin-like modifier-activating enzyme 5 | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
10 | TRIS | natural abundance | 50 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±1.0) mM | |
12 | TCEP | natural abundance | 2 (±0.1) mM | |
13 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
14 | DSS | natural abundance | 0.15 (±0.01) mM |
Bruker AVANCE III HD - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.5 (±0.05), Details 1.2 mM Ubiquitin-fold modifier-conjugating enzyme 1, 0.3 mM [U-100% 13C; U-100% 15N] Ubiquitin-like modifier-activating enzyme 5, 50 mM TRIS, 100 mM sodium chloride, 2 mM TCEP, 5 mM AEBSF protease inhibitor, 0.15 mM DSS, 95% H2O/5% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Ubiquitin-fold modifier-conjugating enzyme 1 | natural abundance | 1.2 (±0.05) mM | |
9 | Ubiquitin-like modifier-activating enzyme 5 | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
10 | TRIS | natural abundance | 50 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±1.0) mM | |
12 | TCEP | natural abundance | 2 (±0.1) mM | |
13 | AEBSF protease inhibitor | natural abundance | 5 (±0.1) mM | |
14 | DSS | natural abundance | 0.15 (±0.01) mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34638_3.str
Assigned chemical shifts
--------10--------20------- GMSVTELTVEDSGESLEDLMAKMKNMW | ||||||||||||||||||||||||| G.SVTELTVEDSGESLEDLMAKMKNMW
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVP -------110-------120-------130-------140-------150-------160------- ELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ ||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ELDGKTA.MYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 156 | 142 | 91.0 |
13C chemical shifts | 117 | 81 | 69.2 |
15N chemical shifts | 29 | 28 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 52 | 92.9 |
13C chemical shifts | 54 | 26 | 48.1 |
15N chemical shifts | 27 | 26 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 100 | 90 | 90.0 |
13C chemical shifts | 63 | 55 | 87.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 16 | 94.1 |
13C chemical shifts | 17 | 16 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 6 | 1 | 16.7 |
13C chemical shifts | 5 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1072 | 1034 | 96.5 |
13C chemical shifts | 797 | 595 | 74.7 |
15N chemical shifts | 186 | 168 | 90.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 334 | 322 | 96.4 |
13C chemical shifts | 334 | 164 | 49.1 |
15N chemical shifts | 157 | 149 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 738 | 712 | 96.5 |
13C chemical shifts | 463 | 431 | 93.1 |
15N chemical shifts | 29 | 19 | 65.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 94 | 94 | 100.0 |
13C chemical shifts | 94 | 94 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 98 | 94 | 95.9 |
13C chemical shifts | 92 | 67 | 72.8 |
15N chemical shifts | 6 | 6 | 100.0 |