NMR Structure of RgpB C-terminal Domain
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.2 % (829 of 996) | 78.5 % (397 of 506) | 89.1 % (350 of 393) | 84.5 % (82 of 97) |
Backbone | 85.6 % (459 of 536) | 78.3 % (144 of 184) | 89.8 % (237 of 264) | 88.6 % (78 of 88) |
Sidechain | 80.1 % (436 of 544) | 76.7 % (247 of 322) | 86.9 % (185 of 213) | 44.4 % (4 of 9) |
Aromatic | 60.3 % (41 of 68) | 61.8 % (21 of 34) | 58.8 % (20 of 34) | |
Methyl | 92.6 % (100 of 108) | 87.0 % (47 of 54) | 98.1 % (53 of 54) |
1. entity 1
MAHHHHHHVD DDDKMGTSIA DVANDKPYTV AVSGKTITVE SPAAGLTIFD MNGRRVATAK NRMVFEAQNG VYAVRIATEG KTYTEKVIVKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Bruker AVANCE III HD - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6, Details 1 mM [U-13C; U-15N] RgpB-CTD (G662-K736), 20 mM sodium phosphate, 50 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RgpB-CTD (G662-K736) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 2 mM |
Properties
Input source #1: Assigned chemical shifts - Assigned chemical shifts | bmr34666_3.str |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | OK |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34666_3.str
# | Content subtype | Saveframe | Status | # of rows | Experiment type | Sequence coverage (%) |
---|---|---|---|---|---|---|
1 | Assigned chemical shifts | assigned_chemical_shifts_1 | OK | 977 | 92.2 (chain: 1, length: 90) | |
1 | Chemical shift references | chem_shift_reference_1 | OK | 3 | No information |
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90 MAHHHHHHVDDDDKMGTSIADVANDKPYTVAVSGKTITVESPAAGLTIFDMNGRRVATAKNRMVFEAQNGVYAVRIATEGKTYTEKVIVK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......HVDDDDKMGTSIADVANDKPYTVAVSGKTITVESPAAGLTIFDMNGRRVATAKNRMVFEAQNGVYAVRIATEGKTYTEKVIVK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 506 | 439 | 86.8 |
13C chemical shifts | 393 | 353 | 89.8 |
15N chemical shifts | 97 | 83 | 85.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 184 | 164 | 89.1 |
13C chemical shifts | 180 | 166 | 92.2 |
15N chemical shifts | 88 | 79 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 322 | 275 | 85.4 |
13C chemical shifts | 213 | 187 | 87.8 |
15N chemical shifts | 9 | 4 | 44.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 51 | 87.9 |
13C chemical shifts | 58 | 53 | 91.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 21 | 61.8 |
13C chemical shifts | 34 | 20 | 58.8 |