Solution structure of the complex between plasmodial ZNHIT3 and NUFIP1 proteins
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.7 % (1185 of 1226) | 97.0 % (622 of 641) | 95.8 % (461 of 481) | 98.1 % (102 of 104) |
Backbone | 99.1 % (573 of 578) | 99.0 % (192 of 194) | 99.7 % (288 of 289) | 97.9 % (93 of 95) |
Sidechain | 95.2 % (707 of 743) | 96.2 % (430 of 447) | 93.4 % (268 of 287) | 100.0 % (9 of 9) |
Aromatic | 75.9 % (85 of 112) | 80.4 % (45 of 56) | 71.4 % (40 of 56) | |
Methyl | 100.0 % (108 of 108) | 100.0 % (54 of 54) | 100.0 % (54 of 54) |
1. entity 1
GPHMDYDMLT EEQKKKLKED HTLKILLKNN YVREVFKQFT LSNDKIGYLS HYINDPTIVQ VIDHIMKTID DT2. entity 2
DIYTYEKKLI KSIEYITKNK FFDDSSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Bruker AVANCE III - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.4, Details 0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfZNHIT3 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | pfNUFIP1 | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | sodium phosphate | natural abundance | 10 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34693_3.str
Assigned chemical shifts
--------10--------20----- DIYTYEKKLIKSIEYITKNKFFDDS ||||||||||||||||||||||||| DIYTYEKKLIKSIEYITKNKFFDDS
--------10--------20--------30--------40--------50--------60--------70-- GPHMDYDMLTEEQKKKLKEDHTLKILLKNNYVREVFKQFTLSNDKIGYLSHYINDPTIVQVIDHIMKTIDDT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPHMDYDMLTEEQKKKLKEDHTLKILLKNNYVREVFKQFTLSNDKIGYLSHYINDPTIVQVIDHIMKTIDDT
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
19 | ASN | CG | 177.638 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 173 | 160 | 92.5 |
13C chemical shifts | 131 | 120 | 91.6 |
15N chemical shifts | 26 | 25 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 49 | 98.0 |
13C chemical shifts | 50 | 50 | 100.0 |
15N chemical shifts | 25 | 24 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 123 | 111 | 90.2 |
13C chemical shifts | 81 | 70 | 86.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 12 | 12 | 100.0 |
13C chemical shifts | 12 | 12 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 16 | 72.7 |
13C chemical shifts | 22 | 14 | 63.6 |
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
10 | THR | HG1 | 5.842 |
13 | GLN | CD | 179.204 |
29 | ASN | CG | 176.302 |
30 | ASN | CG | 176.213 |
38 | GLN | CD | 180.077 |
40 | THR | HG1 | 5.283 |
42 | SER | HG | 5.16 |
43 | ASN | CG | 176.944 |
54 | ASN | CG | 177.638 |
60 | GLN | CD | 179.782 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 468 | 462 | 98.7 |
13C chemical shifts | 350 | 341 | 97.4 |
15N chemical shifts | 78 | 77 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 144 | 143 | 99.3 |
13C chemical shifts | 144 | 143 | 99.3 |
15N chemical shifts | 70 | 69 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 324 | 319 | 98.5 |
13C chemical shifts | 206 | 198 | 96.1 |
15N chemical shifts | 8 | 8 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 45 | 100.0 |
13C chemical shifts | 45 | 45 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 29 | 85.3 |
13C chemical shifts | 34 | 26 | 76.5 |