Solution structure of yeast Fra2
MPVTEQGLRE RIESAIPQVY HIIVTDLSYG CGQSFDIVVV SDFFQGKSKL MRSRAVNKAV KEELQEIHAF SCKCYTEEEW SKIVVLEHHH HHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 70.6 % (782 of 1108) | 75.1 % (431 of 574) | 62.4 % (272 of 436) | 80.6 % (79 of 98) |
Backbone | 74.2 % (411 of 554) | 83.5 % (157 of 188) | 64.0 % (176 of 275) | 85.7 % (78 of 91) |
Sidechain | 70.1 % (451 of 643) | 71.0 % (274 of 386) | 70.4 % (176 of 250) | 14.3 % (1 of 7) |
Aromatic | 3.7 % (4 of 108) | 3.7 % (2 of 54) | 3.8 % (2 of 53) | 0.0 % (0 of 1) |
Methyl | 98.0 % (100 of 102) | 96.1 % (49 of 51) | 100.0 % (51 of 51) |
1. BolA-like protein 2
MPVTEQGLRE RIESAIPQVY HIIVTDLSYG CGQSFDIVVV SDFFQGKSKL MRSRAVNKAV KEELQEIHAF SCKCYTEEEW SKIVVLEHHH HHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
6 | NaCl | natural abundance | salt | 150 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
6 | NaCl | natural abundance | salt | 150 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
6 | NaCl | natural abundance | salt | 150 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
2 | NaCl | natural abundance | salt | 150 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 8.0, Details 0.8 mM 15N,13C_labelled Fra2, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Fra2 | [U-13C; U-15N] | protein | 0.8 mM |
6 | NaCl | natural abundance | salt | 150 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_36111_5y4b.nef |
Input source #2: Coordindates | 5y4b.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---40--------50--------60--------70--------80--------90-------100-------110-------120-------- MPVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQGKSKLMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVVLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQGKSKLMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVVLEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 93 | 0 | 0 | 100.0 |
Content subtype: combined_36111_5y4b.nef
Assigned chemical shifts
---40--------50--------60--------70--------80--------90-------100-------110-------120-------- MPVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQGKSKLMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVVLEHHHHHH ||||||||||||||||||||||||||| |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| .PVTEQGLRERIESAIPQVYHIIVTDLS..CGQSFDIVVVSDFFQGKS.LMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVVLEH ---40--------50--------60--------70--------80--------90-------100-------110-------120---
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 574 | 437 | 76.1 |
13C chemical shifts | 436 | 254 | 58.3 |
15N chemical shifts | 102 | 76 | 74.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 188 | 160 | 85.1 |
13C chemical shifts | 186 | 81 | 43.5 |
15N chemical shifts | 91 | 76 | 83.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 386 | 277 | 71.8 |
13C chemical shifts | 250 | 173 | 69.2 |
15N chemical shifts | 11 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 51 | 96.2 |
13C chemical shifts | 53 | 51 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 0 | 0.0 |
13C chemical shifts | 53 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
---40--------50--------60--------70--------80--------90-------100-------110-------120-------- MPVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQGKSKLMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVVLEHHHHHH ||||||||||||||||||||||||||| |||||||||||| | ||||||||||||||||||||||||||||||||||||||| .PVTEQGLRERIESAIPQVYHIIVTDLS.....SFDIVVVSDFFQ..S.LMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVVLEH ---40--------50--------60--------70--------80--------90-------100-------110-------120---
---40--------50--------60--------70--------80--------90-------100-------110-------120-------- MPVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQGKSKLMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVVLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQGKSKLMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVV ---40--------50--------60--------70--------80--------90-------100-------110-------120