Structure of the Ets-1 Pointed Domain and Mitogen-activiated Protein Kinase Phosphorylation Site.
MECADVPLLT PSSKEMMSQA LKATFSGFTK EQQRLGIPKD PRQWTETHVR DWVMWAVNEF SLKGVDFQKF CMSGAALCAL GKECFLELAP DFVGDILWEH LEILQKEDVK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.4 % (1231 of 1318) | 93.6 % (642 of 686) | 92.4 % (477 of 516) | 96.6 % (112 of 116) |
Backbone | 95.4 % (620 of 650) | 95.9 % (212 of 221) | 94.8 % (307 of 324) | 96.2 % (101 of 105) |
Sidechain | 92.4 % (713 of 772) | 92.5 % (430 of 465) | 91.9 % (272 of 296) | 100.0 % (11 of 11) |
Aromatic | 91.3 % (115 of 126) | 100.0 % (63 of 63) | 81.4 % (48 of 59) | 100.0 % (4 of 4) |
Methyl | 98.2 % (112 of 114) | 96.5 % (55 of 57) | 100.0 % (57 of 57) |
1. ETS-1 Pointed domain
MECADVPLLT PSSKEMMSQA LKATFSGFTK EQQRLGIPKD PRQWTETHVR DWVMWAVNEF SLKGVDFQKF CMSGAALCAL GKECFLELAP DFVGDILWEH LEILQKEDVKPressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | null | direct | 0.0 |
1H | DSS | methyl protons | 0.0 ppm | null | direct | 0.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | null | direct | 0.0 |
1H | DSS | methyl protons | 0.0 ppm | null | direct | 0.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | null | direct | 0.0 |
1H | DSS | methyl protons | 0.0 ppm | null | direct | 0.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | null | direct | 0.0 |
1H | DSS | methyl protons | 0.0 ppm | null | direct | 0.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Varian UNITY - 500 MHz
State isotropic, Pressure 1.0 atm, Temperature 303 (±2) K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ETS-1 Pointed domain | [U-99% 15N; U-99% 13C] | 1.2 ~ 0.0 mM | |
2 | KPO4 | 10 mM | ||
3 | KCl | 10 mM | ||
4 | DTT | 10 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr4205_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEH |||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ECADVPLLTP.SKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEH -------110 LEILQKEDVK |||||||||| LEILQKEDVK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
19 | GLN | CD | 180.03 |
32 | GLN | CD | 179.14 |
33 | GLN | CD | 179.92 |
43 | GLN | CD | 180.14 |
48 | HIS | ND1 | 255.3 |
48 | HIS | NE2 | 166.32 |
58 | ASN | CG | 176.21 |
68 | GLN | CD | 180.36 |
100 | HIS | ND1 | 255.7 |
100 | HIS | NE2 | 163.5 |
105 | GLN | CD | 179.28 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 686 | 649 | 94.6 |
13C chemical shifts | 516 | 478 | 92.6 |
15N chemical shifts | 119 | 112 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 221 | 214 | 96.8 |
13C chemical shifts | 220 | 206 | 93.6 |
15N chemical shifts | 105 | 101 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 465 | 435 | 93.5 |
13C chemical shifts | 296 | 272 | 91.9 |
15N chemical shifts | 14 | 11 | 78.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 60 | 96.8 |
13C chemical shifts | 62 | 60 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 63 | 100.0 |
13C chemical shifts | 59 | 48 | 81.4 |
15N chemical shifts | 4 | 4 | 100.0 |