Assignment of 1H, 13C and 15N signals of a recombinant effector protein (T4MOD) in Toluene-4-monooxygenase complex
STLADQALHN NNVGPIIRAG DLVEPVIETA EIDNPGKEIT VEDRRAYVRI AAEGELILTR KTLEEQLGRP FNMQELEINL ASFAGQIQAD EDQIRFYFDK TM
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.8 % (1131 of 1181) | 95.8 % (589 of 615) | 95.4 % (435 of 456) | 97.3 % (107 of 110) |
Backbone | 95.5 % (577 of 604) | 95.1 % (196 of 206) | 95.3 % (286 of 300) | 96.9 % (95 of 98) |
Sidechain | 96.1 % (647 of 673) | 96.1 % (393 of 409) | 96.0 % (242 of 252) | 100.0 % (12 of 12) |
Aromatic | 93.3 % (56 of 60) | 93.3 % (28 of 30) | 93.3 % (28 of 30) | |
Methyl | 96.1 % (123 of 128) | 95.3 % (61 of 64) | 96.9 % (62 of 64) |
1. T4MOD
STLADQALHN NNVGPIIRAG DLVEPVIETA EIDNPGKEIT VEDRRAYVRI AAEGELILTR KTLEEQLGRP FNMQELEINL ASFAGQIQAD EDQIRFYFDK TMTemperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | T4MOD | [U-13C; U-15N] | 1.1 mM |
Temperature 298 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | T4MOD | 2.5 ~ 3.5 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr4560_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 STLADQALHNNNVGPIIRAGDLVEPVIETAEIDNPGKEITVEDRRAYVRIAAEGELILTRKTLEEQLGRPFNMQELEINLASFAGQIQADEDQIRFYFDK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TLADQALHNNNVGPIIRAGDLVEPVIETAEIDNPGKEITVEDRRAYVRIAAEGELILTRKTLEEQLGRPFNMQELEINLASFAGQIQADEDQIRFYFDK -- TM || TM
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
6 | GLN | CD | 180.43 |
10 | ASN | CG | 176.93 |
11 | ASN | CG | 176.93 |
12 | ASN | CG | 176.03 |
18 | ARG | CZ | 158.85 |
34 | ASN | CG | 179.43 |
49 | ARG | CZ | 159.53 |
60 | ARG | CZ | 159.35 |
66 | GLN | CD | 178.23 |
69 | ARG | CZ | 160.13 |
72 | ASN | CG | 176.73 |
74 | GLN | CD | 180.43 |
79 | ASN | CG | 177.63 |
86 | GLN | CD | 180.53 |
88 | GLN | CD | 180.03 |
93 | GLN | CD | 180.23 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 615 | 602 | 97.9 |
13C chemical shifts | 456 | 442 | 96.9 |
15N chemical shifts | 117 | 111 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 206 | 202 | 98.1 |
13C chemical shifts | 204 | 196 | 96.1 |
15N chemical shifts | 98 | 95 | 96.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 409 | 400 | 97.8 |
13C chemical shifts | 252 | 246 | 97.6 |
15N chemical shifts | 19 | 16 | 84.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 64 | 97.0 |
13C chemical shifts | 66 | 64 | 97.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 28 | 93.3 |
13C chemical shifts | 30 | 28 | 93.3 |