Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Content subtype: bmr4715_3.str

Assigned chemical shifts

1. Saveframe: YQJ8_ww
   • Status: Warning
   • Sequence coverage of experimental data
     • Entity_assembly_ID: 1, Chain length: 37, Sequence coverage: 94.6%

     --------10--------20--------30-------
     MGGRLPPGWEIIHENGRPLYYNAEQKTKLHYPPSGSS
       |||||||||||||||||||||||||||||||||||
     ..GRLPPGWEIIHENGRPLYYNAEQKTKLHYPPSGSS
     

   • Total number of assignments
     • ¹H chemical shifts: 223
   • Completeness of assignments
     • Entity_assemble_ID: 1
       • Excluded Atom_ID in statistics

         Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
         13	HIS	HD1	7.628
         30	HIS	HD1	6.83

       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	233	197	84.5

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	74	69	93.2

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	159	128	80.5

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	13	12	92.3

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	22	14	63.6

   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: 1