BMRBj - BMREntryMaster

Found 1 Document (2.302 seconds)

BMRB: 4898

1JOC

Assignment of 1H, 13C, 15N and 31P resonances of the FYVE domain in the complex with phosphatidylinositol 3-phosphate.

Authors

Kutateladze, T.G., Overduin, M.

Assembly

complex of the FYVE domain of EEA1 with PtdIns3P

Entity

1. Early Endosome Antigen 1 (polymer, Thiol state: all other bound), 86 monomers, 9579.795 Da Detail

AVQELGRENQ SLQIKHTQAL NRKWAEDNEV QNCMACGKGF SVTVRRHHCR QCGNIFCAEC SAKNALTPSS KKPVRVCDAC FNDLQG

2. 1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol] (non-polymer), 1 monomers, na Da
3. ZINC ION (non-polymer), 65.409 × 2 Da

Total weight

9710.613 Da

Max. entity weight

9579.795 Da

Entity Connection

na 8 Detail

ID	Type	Value order	Atom ID 1	Atom ID 2
1	na	sing	1:CYS33:SG	3:ZN1:ZN
2	na	sing	1:CYS36:SG	3:ZN1:ZN
3	na	sing	1:CYS49:SG	3:ZN1:ZN
4	na	sing	1:CYS60:SG	3:ZN1:ZN
5	na	sing	1:CYS52:SG	3:ZN1:ZN
6	na	sing	1:CYS57:SG	3:ZN1:ZN
7	na	sing	1:CYS77:SG	3:ZN1:ZN
8	na	sing	1:CYS80:SG	3:ZN1:ZN

Source organism

Homo sapiens

Exptl. method

NMR

Data set

assigned_chemical_shifts

Chem. Shift Complete1

Sequence coverage: 100.0 %, Completeness: 98.6 %, Completeness (bb): 98.8 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	98.6 % (960 of 974)	98.8 % (506 of 512)	97.8 % (355 of 363)	100.0 % (99 of 99)
Backbone	98.8 % (506 of 512)	98.9 % (173 of 175)	98.4 % (249 of 253)	100.0 % (84 of 84)
Sidechain	98.3 % (534 of 543)	98.8 % (333 of 337)	97.4 % (186 of 191)	100.0 % (15 of 15)
Aromatic	100.0 % (54 of 54)	100.0 % (27 of 27)	100.0 % (26 of 26)	100.0 % (1 of 1)
Methyl	97.3 % (72 of 74)	97.3 % (36 of 37)	97.3 % (36 of 37)

1. Early Endosome Antigen 1

AVQELGRENQ SLQIKHTQAL NRKWAEDNEV QNCMACGKGF SVTVRRHHCR QCGNIFCAEC SAKNALTPSS KKPVRVCDAC FNDLQG

Show sample condition

Sample

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Chem. Shift Complete2

Sequence coverage: 18.6 %, Completeness: 54.7 %, Completeness (bb): 55.6 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	54.7 % (1065 of 1948)	55.2 % (565 of 1024)	52.8 % (383 of 726)	59.1 % (117 of 198)
Backbone	55.6 % (569 of 1024)	56.0 % (196 of 350)	54.2 % (274 of 506)	58.9 % (99 of 168)
Sidechain	53.4 % (580 of 1086)	54.7 % (369 of 674)	50.5 % (193 of 382)	60.0 % (18 of 30)
Aromatic	56.5 % (61 of 108)	61.1 % (33 of 54)	50.0 % (26 of 52)	100.0 % (2 of 2)
Methyl	50.0 % (74 of 148)	51.4 % (38 of 74)	48.6 % (36 of 74)

1. Early Endosome Antigen 1

AVQELGRENQ SLQIKHTQAL NRKWAEDNEV QNCMACGKGF SVTVRRHHCR QCGNIFCAEC SAKNALTPSS KKPVRVCDAC FNDLQG

Show sample condition

Sample

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291
³¹P	DSS	methyl protons	null	indirect	0.4048086
¹³C	DSS	methyl protons	null	indirect	0.2514495

Referencing offset: -0.05 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291
³¹P	DSS	methyl protons	null	indirect	0.4048086
¹³C	DSS	methyl protons	null	indirect	0.2514495

Referencing offset: -0.05 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291
³¹P	DSS	methyl protons	null	indirect	0.4048086
¹³C	DSS	methyl protons	null	indirect	0.2514495

Referencing offset: -0.02 ppm, Outliers: 2 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291
³¹P	DSS	methyl protons	null	indirect	0.4048086
¹³C	DSS	methyl protons	null	indirect	0.2514495

Referencing offset: 0.19 ppm, Outliers: 2 Detail

Release date

2005-06-01

Citation 1

Multivalent mechanism of membrane insertion by the FYVE domain
Kutateladze, T.G., Capelluto, D.G., Ferguson, C.G., Cheever, M.L., Kutateladze, A.G., Prestwich, G.D., Overduin, M.
J. Biol. Chem. (2004), 279, 3050-3057, PubMed 14578346 , DOI 10.1074/jbc.M309007200 , Abstract

Show more 2 citaions

Citation 2

NMRPipe: a multidimensional spectral processing system based on UNIX pipes
Delaglio, F., Grzesiek, S., Vuister, G.W., Zhu, G., Pfeifer, J., Bax, A.
J. Biomol. NMR (1995), 6, 277-293, PubMed 8520220 , Abstract

Citation 3

A Common Sense Approach to Peak Picking in Two-, Three-, and Four-Dimensional Spectra Uning Automatic Computer Analysis of Contour Diagrams
Garrett, D.S., Powers, R., Gronenborn, A.M., Clore, G.M.
J. Magn. Reson. (1991), 95, 214-220, PubMed , DOI:

Hide non-primary 2 citaions

Related entities 1. Early Endosome Antigen 1, : 1 : 2 : 36 entities Detail

Interaction partners 1. Early Endosome Antigen 1, : 48 interactors Detail

More details for 48 interactors identified by 31 citations

Experiments performed 12 experiments Detail

1 2D DIPSI

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

2 2D NOESY

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

3 1H-15N HSQC

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

4 1H-13C HSQC

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

5 1H-15N NOESY

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

6 1H-15N HMQCJ

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

7 1H-13C NOESY

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

8 H(CCO)NH TOCSY

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

9 C(CO)NH TOCSY

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

10 1H-31P HARTMANN-HAHN

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

11 HNHA

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

12 13C F1-filtered, F2-edited NOESY

Instrument

#1 Model Varian Inova (600 MHz)

#2 Model Varian Inova (500 MHz)

#3 Model Varian Mercury (400 MHz)

Sample #1

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
1	Early Endosome Antigen 1	[U-15N]	2.0 mM
2	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
3	ZINC (II) ION		2.0 mM

Sample #2

Temperature 298 (±1) K, pH 6.7 (±0.1)

#	Name	Isotope labeling	Concentration
4	Early Endosome Antigen 1	[U-15N; U-13C]	2.0 mM
5	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]		1.0 mM
6	ZINC (II) ION		2.0 mM

Chemical shift validation 6 contents Detail

Properties

Input source #1: Assigned chemical shifts - Assigned chemical shifts	bmr4898_3.str
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	True (see coodinates for details)
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
1:33:CYS:SG	3:1:ZN:ZN	reduced, CA 60.7, CB 30.34 ppm	unknown	n/a
1:36:CYS:SG	3:1:ZN:ZN	oxidized 18.4%, reduced 81.6%, CA 59.56, CB 32.93 ppm	unknown	n/a
1:49:CYS:SG	3:1:ZN:ZN	oxidized 20.7%, reduced 79.3%, CA 58.54, CB 32.62 ppm	unknown	n/a
1:60:CYS:SG	3:1:ZN:ZN	reduced, CA 61.07, CB 31.18 ppm	unknown	n/a
1:52:CYS:SG	4:1:ZN:ZN	oxidized 8.9%, reduced 91.1%, CA 59.32, CB 32.25 ppm	unknown	n/a
1:57:CYS:SG	4:1:ZN:ZN	reduced, CA 58.23, CB 31.45 ppm	unknown	n/a
1:77:CYS:SG	4:1:ZN:ZN	reduced, CA 56.93, CB 30.2 ppm	unknown	n/a
1:80:CYS:SG	4:1:ZN:ZN	reduced, CA 65.3, CB 29.35 ppm	unknown	n/a

Non-standard residues

Chain_ID	Seq_ID	Comp_ID	Chem_comp_name	Experimental evidences
2	1	PTDINS3P	1,2 Dibutanoyl-sn-glycero-3-phospho[1D-myo-inositol]	Assigned chemical shifts
3	1	ZN	ZINC ION	None

Content subtype: bmr4898_3.str

#	Content subtype	Saveframe	Status	# of rows	Sequence coverage (%)
1	Assigned chemical shifts	shift_set_1	Warning	1068	100.0 (chain: 1, length: 86)
2	Assigned chemical shifts	shift_set_2	Warning	42	100.0 (chain: 2, length: 1)
1	Chemical shift references	chemical_shift_reference	OK	4	No information

Assigned chemical shifts

Saveframe: shift_set_1

Status: Warning

Sequence coverage of experimental data

Entity_assembly_ID: 1, Chain length: 86, Sequence coverage: 100.0%

--------10--------20--------30--------40--------50--------60--------70--------80------
AVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
AVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG

Total number of assignments
- ¹H chemical shifts: 591
- ¹³C chemical shifts: 368
- ¹⁵N chemical shifts: 109

Completeness of assignments

Entity_assemble_ID: 1

Excluded Atom_ID in statistics

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
3	GLN	CD	180.42
9	ASN	CG	176.97
10	GLN	CD	180.35
13	GLN	CD	180.36
18	GLN	CD	180.66
21	ASN	CG	177.01
28	ASN	CG	176.79
31	GLN	CD	180.15
32	ASN	CG	176.08
46	ARG	HH11	6.58
46	ARG	HH12	6.76
46	ARG	HH21	6.58
46	ARG	HH22	6.76
46	ARG	NH1	71.72
46	ARG	NH2	72.25
50	ARG	HH11	6.29
50	ARG	HH12	6.41
50	ARG	HH21	6.29
50	ARG	HH22	6.41
50	ARG	NH1	70.38
50	ARG	NH2	72.42
51	GLN	CD	178.43
54	ASN	CG	176.54
64	ASN	CG	176.15
82	ASN	CG	176.22
85	GLN	CD	180.44

All atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	512	509	99.4
¹³C chemical shifts	363	354	97.5
¹⁵N chemical shifts	105	105	100.0

Backbone atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	175	174	99.4
¹³C chemical shifts	172	168	97.7
¹⁵N chemical shifts	84	84	100.0

Side chain atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	337	335	99.4
¹³C chemical shifts	191	186	97.4
¹⁵N chemical shifts	21	21	100.0

Methyl group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	38	37	97.4
¹³C chemical shifts	38	37	97.4

Aromatic group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	27	27	100.0
¹³C chemical shifts	26	26	100.0
¹⁵N chemical shifts	1	1	100.0

Redox state of CYS
Peptide bond of PRO
Tautomeric state of HIS
Rotameric state of ILE , LEU, and VAL
Histogram of normalized assigned chemical shifts
Random coil index and derived parameters (S² and NMR RMSD)
- Chain_ID: 1

Saveframe: shift_set_2
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: 2, Chain length: 1, Sequence coverage: 100.0%
- Total number of assignments
  - ¹³C chemical shifts: 15
  - ¹H chemical shifts: 25
  - ³¹P chemical shifts: 2
- Completeness of assignments
  - Entity_assemble_ID: 2

Comp_index_ID	Comp_ID
1	PTDINS3P

Keywords Data processing, software, Peak picking

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (2.302 seconds)

BMRB: 4898

Sample

Sample

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. Early Endosome Antigen 1, : 1 : 2 : 36 entities Detail

Interaction partners 1. Early Endosome Antigen 1, : 48 interactors Detail

Experiments performed 12 experiments Detail

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Instrument

Sample #1

Sample #2

Chemical shift validation 6 contents Detail