1H, 13C, 15N chemical shift assignment of NTD MaSp2 from Nephila clavipes
GSHMAQARSP WSDTATADAF IQNFLAAVSG SGAFTSDQLD DMSTIGDTIM SAMDKMARSN KSSQHKLQAL NMAFASSMAE IAAVEQGGMS MAVKTNAIVD GLNSAFYMTT GAANPQFVNE MRSLISMISA ASANEVSY
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.7 % (1407 of 1470) | 95.8 % (715 of 746) | 96.3 % (548 of 569) | 92.9 % (144 of 155) |
Backbone | 96.2 % (793 of 824) | 95.4 % (269 of 282) | 97.3 % (395 of 406) | 94.9 % (129 of 136) |
Sidechain | 95.6 % (742 of 776) | 96.1 % (446 of 464) | 95.9 % (281 of 293) | 78.9 % (15 of 19) |
Aromatic | 88.5 % (85 of 96) | 93.8 % (45 of 48) | 83.0 % (39 of 47) | 100.0 % (1 of 1) |
Methyl | 100.0 % (140 of 140) | 100.0 % (70 of 70) | 100.0 % (70 of 70) |
1. entity 1
GSHMAQARSP WSDTATADAF IQNFLAAVSG SGAFTSDQLD DMSTIGDTIM SAMDKMARSN KSSQHKLQAL NMAFASSMAE IAAVEQGGMS MAVKTNAIVD GLNSAFYMTT GAANPQFVNE MRSLISMISA ASANEVSYSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Bruker ECA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Uniformly labeled (13C, 15N) of N-terminal domain Major Ampullate Spidroin 2 from Nephila clavipes
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N-terminal domain of Major Ampullate Spidroin 2 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | D2O | [U-100% 2H] | 10 % | |
3 | DSS | natural abundance | 0.1 mM | |
4 | potassium phosphate pH 7 | natural abundance | 10 mM | |
5 | sodium chloride | natural abundance | 300 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr50353_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMAQARSPWSDTATADAFIQNFLAAVSGSGAFTSDQLDDMSTIGDTIMSAMDKMARSNKSSQHKLQALNMAFASSMAEIAAVEQGGMSMAVKTNAIVD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HMAQARSPWSDTATADAFIQNFLAAVSGSGAFTSDQLDDMSTIGDTIMSAMDKMARSNKSSQHKLQALNMAFASSMAEIAAVEQGGMSMAVKTNAIVD -------110-------120-------130-------- GLNSAFYMTTGAANPQFVNEMRSLISMISAASANEVSY |||||||||||||||||||||||||||||||||||||| GLNSAFYMTTGAANPQFVNEMRSLISMISAASANEVSY
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
6 | GLN | CD | 180.431 |
13 | ASP | CG | 180.33 |
18 | ASP | CG | 179.223 |
22 | GLN | CD | 180.137 |
23 | ASN | CG | 175.819 |
31 | SER | HG | 5.627 |
37 | ASP | CG | 180.083 |
40 | ASP | CG | 178.702 |
41 | ASP | CG | 178.705 |
47 | ASP | CG | 179.24 |
54 | ASP | CG | 177.059 |
60 | ASN | CG | 176.344 |
64 | GLN | CD | 180.255 |
68 | GLN | CD | 180.255 |
71 | ASN | CG | 175.041 |
80 | GLU | CD | 183.655 |
85 | GLU | CD | 184.054 |
86 | GLN | CD | 180.297 |
96 | ASN | CG | 176.35 |
100 | ASP | CG | 177.059 |
103 | ASN | CG | 175.21 |
109 | THR | HG1 | 5.631 |
114 | ASN | CG | 175.21 |
116 | GLN | CD | 180.257 |
119 | ASN | CG | 177.822 |
120 | GLU | CD | 182.975 |
135 | GLU | CD | 184.075 |
138 | TYR | CG | 131.79 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 746 | 719 | 96.4 |
13C chemical shifts | 569 | 547 | 96.1 |
15N chemical shifts | 155 | 143 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 282 | 270 | 95.7 |
13C chemical shifts | 276 | 266 | 96.4 |
15N chemical shifts | 136 | 128 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 464 | 449 | 96.8 |
13C chemical shifts | 293 | 281 | 95.9 |
15N chemical shifts | 19 | 15 | 78.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 80 | 97.6 |
13C chemical shifts | 82 | 80 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 45 | 93.8 |
13C chemical shifts | 47 | 39 | 83.0 |
15N chemical shifts | 1 | 1 | 100.0 |