A28
ATHAAFEYSK SIGGTPALDR RVQDVNDTIS DVKQKWRCVV YPGNGFVSAS IFGFQAEVGP NNTRSIRKFN TMQQCIDFTF SDVININIYN PCVVPNINNA ECQFLKSVL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.1 % (1223 of 1272) | 95.9 % (628 of 655) | 96.5 % (473 of 490) | 96.1 % (122 of 127) |
Backbone | 99.1 % (638 of 644) | 98.6 % (216 of 219) | 99.1 % (318 of 321) | 100.0 % (104 of 104) |
Sidechain | 94.0 % (687 of 731) | 94.5 % (412 of 436) | 94.5 % (257 of 272) | 78.3 % (18 of 23) |
Aromatic | 82.5 % (99 of 120) | 83.3 % (50 of 60) | 83.1 % (49 of 59) | 0.0 % (0 of 1) |
Methyl | 95.8 % (113 of 118) | 94.9 % (56 of 59) | 96.6 % (57 of 59) |
1. entity 1
ATHAAFEYSK SIGGTPALDR RVQDVNDTIS DVKQKWRCVV YPGNGFVSAS IFGFQAEVGP NNTRSIRKFN TMQQCIDFTF SDVININIYN PCVVPNINNA ECQFLKSVLSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | A28 | [U-100% 13C; U-100% 15N] | 1 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr50469_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTFSDVININIYNPCVVPNINNA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTFSDVININIYNPCVVPNIN.A --------- ECQFLKSVL ||||||||| ECQFLKSVL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
36 | TRP | CD2 | 128.6 |
36 | TRP | CE2 | 133.58 |
67 | ARG | HH12 | 6.836 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 490 | 469 | 95.7 |
1H chemical shifts | 655 | 617 | 94.2 |
15N chemical shifts | 127 | 116 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 218 | 214 | 98.2 |
1H chemical shifts | 219 | 213 | 97.3 |
15N chemical shifts | 104 | 100 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 272 | 255 | 93.8 |
1H chemical shifts | 436 | 404 | 92.7 |
15N chemical shifts | 23 | 16 | 69.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 60 | 57 | 95.0 |
1H chemical shifts | 60 | 57 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 59 | 49 | 83.1 |
1H chemical shifts | 60 | 50 | 83.3 |
15N chemical shifts | 1 | 0 | 0.0 |