In response to the declaration of global pandemic of Coronavirus infectious disease 2019 (COVID-19) caused by Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), we provide comprehensive content on Coronavirus molecular structures and its interactions:
Nsp3c SUD-C
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.4 % (732 of 767) | 95.4 % (374 of 392) | 95.7 % (291 of 304) | 94.4 % (67 of 71) |
Backbone | 97.0 % (382 of 394) | 94.9 % (130 of 137) | 99.0 % (190 of 192) | 95.4 % (62 of 65) |
Sidechain | 94.7 % (410 of 433) | 95.7 % (244 of 255) | 93.6 % (161 of 172) | 83.3 % (5 of 6) |
Aromatic | 79.3 % (73 of 92) | 82.6 % (38 of 46) | 75.6 % (34 of 45) | 100.0 % (1 of 1) |
Methyl | 100.0 % (68 of 68) | 100.0 % (34 of 34) | 100.0 % (34 of 34) |
1. entity 1
GSEEHFIETI SLAGSYKDWS YSGQSTQLGI EFLKRGDKSV YYTSNPTTFH LDGEVITFDN LKTLLSSolvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-13C; U-15N] | 0.73 mM | |
2 | NaPi | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 2 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr50517_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60------ GSEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 392 | 378 | 96.4 |
13C chemical shifts | 304 | 291 | 95.7 |
15N chemical shifts | 71 | 67 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 137 | 132 | 96.4 |
13C chemical shifts | 132 | 130 | 98.5 |
15N chemical shifts | 65 | 62 | 95.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 255 | 246 | 96.5 |
13C chemical shifts | 172 | 161 | 93.6 |
15N chemical shifts | 6 | 5 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 34 | 100.0 |
13C chemical shifts | 34 | 34 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 38 | 82.6 |
13C chemical shifts | 45 | 34 | 75.6 |
15N chemical shifts | 1 | 1 | 100.0 |